PDGF-CC Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
Background
PDGF-CC Protein, a pivotal growth factor, assumes a critical role in orchestrating diverse cellular processes, spanning embryonic development, cell proliferation, migration, survival, and chemotaxis. Demonstrating potent mitogenic and chemoattractant properties for mesenchymal cells, PDGF-CC emerges as a key player in the intricate landscape of embryonic skeleton formation, particularly in craniofacial and palate development, as well as in the morphogenesis of the skin. Its involvement in wound healing encompasses pivotal contributions to inflammation, proliferation, and remodeling stages. Moreover, PDGF-CC is a central figure in angiogenesis and blood vessel development, wielding influence in fibrotic processes by orchestrating the transformation of interstitial fibroblasts into myofibroblasts and facilitating collagen deposition. Beyond its canonical roles, the CUB domain hints at additional mitogenic activities, particularly in coronary artery smooth muscle cells. In the nucleus, PDGF-CC unveils additional functions, underscoring its multifaceted regulatory capacities. Homodimeric and disulfide-linked, PDGF-CC engages in intricate interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, while also interacting with PLAT via its CUB domain.
Verified Bioactivity
Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 this effect is 61.4 ng/mL, corresponding to a specific activity is 1.6287×10^4 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q8CI19 (V235-G345)
-
Molecular Construction
-
N-term
-
hFc
-
PDGF-CC (V235-G345)
Accession # Q8CI19 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFC; Platelet-Derived Growth Factor C; Platelet Derived Growth Factor C; PDGF-C; Fallotein; VEGF-E; SCDGF; Secretory Growth Factor-Like Protein; Spinal Cord-Derived Growth Factor
-
AA Sequence
VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
-
Predicted Molecular Mass
40.9 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)