PDGF-CC Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Background

PDGF-CC Protein, a pivotal growth factor, assumes a critical role in orchestrating diverse cellular processes, spanning embryonic development, cell proliferation, migration, survival, and chemotaxis. Demonstrating potent mitogenic and chemoattractant properties for mesenchymal cells, PDGF-CC emerges as a key player in the intricate landscape of embryonic skeleton formation, particularly in craniofacial and palate development, as well as in the morphogenesis of the skin. Its involvement in wound healing encompasses pivotal contributions to inflammation, proliferation, and remodeling stages. Moreover, PDGF-CC is a central figure in angiogenesis and blood vessel development, wielding influence in fibrotic processes by orchestrating the transformation of interstitial fibroblasts into myofibroblasts and facilitating collagen deposition. Beyond its canonical roles, the CUB domain hints at additional mitogenic activities, particularly in coronary artery smooth muscle cells. In the nucleus, PDGF-CC unveils additional functions, underscoring its multifaceted regulatory capacities. Homodimeric and disulfide-linked, PDGF-CC engages in intricate interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, while also interacting with PLAT via its CUB domain.

Verified Bioactivity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 this effect is 61.4 ng/mL, corresponding to a specific activity is 1.6287×10^4 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is 61.4 ng/mL, corresponding to a specific activity is 1.6287×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • PDGF-CC (V235-G345)
      Accession # Q8CI19
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDGFC; Platelet-Derived Growth Factor C; Platelet Derived Growth Factor C; PDGF-C; Fallotein; VEGF-E; SCDGF; Secretory Growth Factor-Like Protein; Spinal Cord-Derived Growth Factor

  • AA Sequence

    VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

  • Predicted Molecular Mass

    40.9 kDa

  • Molecular Weight

    Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00