1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-C
  6. PDGF-CC Protein, Mouse (HEK293, Fc)

PDGF-CC Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P73354
COA Handling Instructions

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag. The total length of PDGF-CC Protein, Mouse (HEK293, Fc) is 111 a.a., with molecular weight of ~46 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $82 In-stock
50 μg $230 In-stock
100 μg $390 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag. The total length of PDGF-CC Protein, Mouse (HEK293, Fc) is 111 a.a., with molecular weight of ~46 kDa.

Background

PDGF-CC Protein, a pivotal growth factor, assumes a critical role in orchestrating diverse cellular processes, spanning embryonic development, cell proliferation, migration, survival, and chemotaxis. Demonstrating potent mitogenic and chemoattractant properties for mesenchymal cells, PDGF-CC emerges as a key player in the intricate landscape of embryonic skeleton formation, particularly in craniofacial and palate development, as well as in the morphogenesis of the skin. Its involvement in wound healing encompasses pivotal contributions to inflammation, proliferation, and remodeling stages. Moreover, PDGF-CC is a central figure in angiogenesis and blood vessel development, wielding influence in fibrotic processes by orchestrating the transformation of interstitial fibroblasts into myofibroblasts and facilitating collagen deposition. Beyond its canonical roles, the CUB domain hints at additional mitogenic activities, particularly in coronary artery smooth muscle cells. In the nucleus, PDGF-CC unveils additional functions, underscoring its multifaceted regulatory capacities. Homodimeric and disulfide-linked, PDGF-CC engages in intricate interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, while also interacting with PLAT via its CUB domain.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 this effect is 61.4 ng/mL, corresponding to a specific activity is 1.6287×10^4 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is 61.4 ng/mL, corresponding to a specific activity is 1.6287×104 units/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q8CI19 (V235-G345)

Gene ID

54635  [NCBI]

Molecular Construction
N-term
hFc
PDGF-CC (V235-G345)
Accession # Q8CI19
C-term
Synonyms
PDGF-C; Platelet derived growth factor C; VEGF-E; SCDGF
AA Sequence

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Molecular Weight

Approximately 46 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDGF-CC Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-CC Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73354
Quantity:
MCE Japan Authorized Agent: