PDGF R beta Protein, Rat (HEK293, His)

PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGF R beta Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-His labeled tag.

PDGFRA is a receptor tyrosine kinase that binds to several ligands, including PDGFA, PDGFB, and PDGFD. These ligands can form homodimers or heterodimers, and binding of these ligands to PDGFRA activates several signaling cascades. The specific response depends on the ligand bound and can be modulated by the formation of heterodimers with another receptor, PDGFRB.

Human PDGFB, His Tag immobilized on CM5 Chip can bind Rat PDGF R beta, His Tag with an affinity constant of 67.56 nM as determined in SPR assay (Biacore T200).

Rat

HEK293

C-His

Q05030 (L32-V531)

24629  [NCBI]

Extracellular Domain

LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKV

80-110 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.