1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. PDGFs & PDGFRs Platelet CD Proteins Endothelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. CD140b/PDGF-R-beta PDGFR
  5. PDGF-R-beta
  6. PDGF R beta Protein, Rat (HEK293, His)

PDGF R beta Protein, Rat (HEK293, His)

Cat. No.: HY-P73360
COA Handling Instructions

PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers. Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand. The modulation of responses involves heterodimer formation with another receptor, PDGFRB. PDGF R beta Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-His labeled tag. The total length of PDGF R beta Protein, Rat (HEK293, His) is 500 a.a., with molecular weight of 80-110 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $49 In-stock
10 μg $84 In-stock
50 μg $235 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers. Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand. The modulation of responses involves heterodimer formation with another receptor, PDGFRB. PDGF R beta Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-His labeled tag. The total length of PDGF R beta Protein, Rat (HEK293, His) is 500 a.a., with molecular weight of 80-110 kDa.

Background

PDGFRA is a receptor tyrosine kinase that binds to several ligands, including PDGFA, PDGFB, and PDGFD. These ligands can form homodimers or heterodimers, and binding of these ligands to PDGFRA activates several signaling cascades. The specific response depends on the ligand bound and can be modulated by the formation of heterodimers with another receptor, PDGFRB.

Biological Activity

Human PDGFB, His Tag immobilized on CM5 Chip can bind Rat PDGF R beta, His Tag with an affinity constant of 67.56 nM as determined in SPR assay (Biacore T200).

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q05030 (L32-V531)

Gene ID
Molecular Construction
N-term
PDGF R beta (L32-V531)
Accession # Q05030
His
C-term
Synonyms
Platelet-derived growth factor receptor beta; PDGF-R-beta; PDGFR-1; CD140b; PDGFRB
AA Sequence

LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKV

Molecular Weight

80-110 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF R beta Protein, Rat (HEK293, His)
Cat. No.:
HY-P73360
Quantity:
MCE Japan Authorized Agent: