1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. PDGFs & PDGFRs Platelet CD Proteins Endothelial cell CD Proteins Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases
  4. PDGFR
  5. PDGF-R-beta
  6. PDGFRB Protein, Rat (HEK293, His)

PDGFRB Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGFRB Protein, Rat (HEK293, His) is the recombinant rat-derived PDGFRB Protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGFRB Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGFRB Protein, Rat (HEK293, His) is the recombinant rat-derived PDGFRB Protein, expressed by HEK293 , with C-His labeled tag.

Biological Activity

1.This product does not contain protein kinase domain.
2.Human PDGFB, His Tag immobilized on CM5 Chip can bind Rat PDGF R beta, His Tag with an affinity constant of 67.56 nM as determined in SPR assay (Biacore T200).

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q05030 (L32-V531)

Gene ID
Molecular Construction
N-term
PDGF R beta (L32-V531)
Accession # Q05030
His
C-term
Protein Length

Extracellular Domain

Synonyms
Platelet-derived growth factor receptor beta; PDGF-R-beta; PDGFR-1; CD140b; PDGFRB
AA Sequence

LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKV

Predicted Molecular Mass
57.4 kDa
Molecular Weight

Approximately 80-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDGFRB Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGFRB Protein, Rat (HEK293, His)
Cat. No.:
HY-P73360
Quantity:
MCE Japan Authorized Agent: