PDZD11 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PDZD11 protein is a key mediator that promotes the docking of ADAM10 to adhesion zonules by interacting with PLEKHA7. PDZD11 is critical for subsequent binding to TSPAN33, which orchestrates complex protein-protein interactions at cellular junctions. PDZD11 Protein, Human (His) is the recombinant human-derived PDZD11 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDZD11 protein is a key mediator that promotes the docking of ADAM10 to adhesion zonules by interacting with PLEKHA7. PDZD11 is critical for subsequent binding to TSPAN33, which orchestrates complex protein-protein interactions at cellular junctions. PDZD11 Protein, Human (His) is the recombinant human-derived PDZD11 protein, expressed by E. coli , with N-His labeled tag.

Background

PDZD11 Protein serves as a pivotal mediator in cellular interactions, facilitating the docking of ADAM10 to the zonula adherens through its interaction with PLEKHA7. This interaction is essential for the subsequent binding of PLEKHA7 to the ADAM10-binding protein TSPAN33, highlighting PDZD11's role in coordinating intricate protein-protein interactions at cellular junctions. Moreover, PDZD11 exhibits interactions with ATP2B1, ATP2B2, ATP2B3, ATP2B4, and ATP7A, implicating its involvement in calcium and copper transport processes. Its interaction with PLEKHA7 at the zonula adherens underscores its significance in the regulation of cell adhesion and signaling. Additionally, PDZD11 interacts with SLC5A6, indicating potential involvement in the modulation of sodium-dependent transport processes. The complex network of interactions suggests that PDZD11 plays a crucial role in orchestrating diverse cellular functions, warranting further investigation to unravel the precise molecular mechanisms and broader implications of PDZD11 in cellular signaling and junctional dynamics.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • PDZD11 (D2-H140)
      Accession # Q5EBL8-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PDZD11; PDZ Domain-Containing Protein 11; Prev. PDZK11; AIPP1; Plasma Membrane Calcium ATPase-Interacting Single-PDZ Protein; PISP; PMCA-Interacting Single-PDZ Protein; PDZ Domain Containing 11; ATPase-Interacting PDZ Protein

  • AA Sequence

    DSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00