PDZD11 Protein, Human (His)

PDZD11 protein is a key mediator that promotes the docking of ADAM10 to adhesion zonules by interacting with PLEKHA7. PDZD11 is critical for subsequent binding to TSPAN33, which orchestrates complex protein-protein interactions at cellular junctions. PDZD11 Protein, Human (His) is the recombinant human-derived PDZD11 protein, expressed by E. coli , with N-His labeled tag. The total length of PDZD11 Protein, Human (His) is 139 a.a., with molecular weight of ~18 kDa.

PDZD11 Protein serves as a pivotal mediator in cellular interactions, facilitating the docking of ADAM10 to the zonula adherens through its interaction with PLEKHA7. This interaction is essential for the subsequent binding of PLEKHA7 to the ADAM10-binding protein TSPAN33, highlighting PDZD11's role in coordinating intricate protein-protein interactions at cellular junctions. Moreover, PDZD11 exhibits interactions with ATP2B1, ATP2B2, ATP2B3, ATP2B4, and ATP7A, implicating its involvement in calcium and copper transport processes. Its interaction with PLEKHA7 at the zonula adherens underscores its significance in the regulation of cell adhesion and signaling. Additionally, PDZD11 interacts with SLC5A6, indicating potential involvement in the modulation of sodium-dependent transport processes. The complex network of interactions suggests that PDZD11 plays a crucial role in orchestrating diverse cellular functions, warranting further investigation to unravel the precise molecular mechanisms and broader implications of PDZD11 in cellular signaling and junctional dynamics.

Human

E. coli

N-His

Q5EBL8 (D2-H140)

51248  [NCBI]

DSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

Approximately 18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.