RKIP/PEBP1 Protein, Human
Based on 1 Customer Validation
The RKIP/PEBP1 protein has diverse binding capabilities and can interact with ATP, opioids, and phosphatidylethanolamine. It acts as a serine protease inhibitor, effectively inhibiting thrombin, neuroproteases, and chymotrypsin. RKIP/PEBP1 Protein, Human is the recombinant human-derived RKIP/PEBP1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RKIP/PEBP1 protein has diverse binding capabilities and can interact with ATP, opioids, and phosphatidylethanolamine. It acts as a serine protease inhibitor, effectively inhibiting thrombin, neuroproteases, and chymotrypsin. RKIP/PEBP1 Protein, Human is the recombinant human-derived RKIP/PEBP1 protein, expressed by E. coli , with tag free.
Background
The RKIP/PEBP1 protein exhibits versatile binding capabilities, interacting with ATP, opioids, and phosphatidylethanolamine, while displaying lower affinity for phosphatidylinositol and phosphatidylcholine. This protein serves as a serine protease inhibitor, effectively inhibiting thrombin, neuropsin, and chymotrypsin, albeit not trypsin, tissue-type plasminogen activator, and elastase. Notably, RKIP/PEBP1 plays a pivotal role in modulating the kinase activity of RAF1 by impeding its activation, dissociating the RAF1/MEK complex, and acting as a competitive inhibitor of MEK phosphorylation. Additionally, it is implicated in the function of presynaptic cholinergic neurons in the central nervous system, enhancing the production of choline acetyltransferase without affecting acetylcholinesterase. This regulatory function appears to be mediated by a specific receptor.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P30086 (M1-K187)
-
Molecular Construction
-
N-term
-
RKIP (M1-K187)
Accession # P30086 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PEBP1; Prostatic Binding Protein; Prev. PBP; PEBP-1; RKIP; Epididymis Secretory Protein Li 34; PEBP; Epididymis Secretory Protein Li 96; Phosphatidylethanolamine-Binding Protein 1; Epididymis Luminal Protein 210; HCNPpp; Prostatic-Binding Protein; HCNP; H
-
AA Sequence
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
-
Molecular Weight
Approximately 21.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
