S100A10 Protein, Human (His)

S100A10 Protein is pivotal in modulating protein phosphorylation by promoting ANXA2/p36 dimerization. The ANXA2 monomer is the favored substrate for tyrosine-specific kinase activity in vitro. A heterotetramer, composed of S100A10/p11 and ANXA2/p36, highlights intricate regulatory dynamics. This interaction landscape includes SCN10A and TASOR, showcasing S100A10's multifaceted involvement in cellular processes. S100A10 Protein, Human (His) is the recombinant human-derived S100A10 protein, expressed by E. coli, with N-6*His labeled tag. The total length of S100A10 Protein, Human (His) is 96 a.a., with molecular weight of ~13 kDa.

S100A10 protein plays a pivotal role in modulating protein phosphorylation by promoting the dimerization of ANXA2/p36. The ANXA2 monomer emerges as the preferred substrate for tyrosine-specific kinase activity in vitro. Furthermore, the formation of a heterotetramer, consisting of two light chains of S100A10/p11 and two heavy chains of ANXA2/p36, underscores the intricate regulatory dynamics. This interaction landscape extends to include SCN10A and TASOR, emphasizing the multifaceted involvement of S100A10 in cellular processes.

Data is not available.

Human

E. coli

N-6*His

P60903 (P2-K97)

6281  [NCBI]

PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Approximately 13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.