Copy Link Print Information

Serglycin/SRGN Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Serglycin/SRGN Protein, Human (HEK293, His) is the recombinant human-derived Serglycin/SRGN, expressed by HEK293 , with C-10*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Serglycin/SRGN Protein, Human (HEK293, His)
  • Experimental Validation Results for Serglycin/SRGN Protein, Human (HEK293, His)
  • Serglycin/SRGN Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Serglycin/SRGN Protein, Human (HEK293, His) is the recombinant human-derived Serglycin/SRGN, expressed by HEK293 , with C-10*His labeled tag. ,

Background

Serglycin (SRGN) serves as a crucial player in the formation of mast cell secretory granules, facilitating the storage of various compounds within secretory vesicles. Its indispensability is underscored by its role in storing proteases in connective tissue and mucosal mast cells, including the storage of granzyme B in T-lymphocytes. SRGN also contributes to the localization of neutrophil elastase in azurophil granules of neutrophils. Furthermore, it participates in the processing of MMP2 and, notably, plays a key role in granule-mediated apoptosis by forming a complex with granzyme B. This complex is delivered to cells by perforin, inducing apoptosis. Beyond its involvement in cytotoxic cell granule-mediated processes, SRGN regulates the secretion of TNF-alpha and potentially influences protease secretion. Intriguingly, SRGN exhibits inhibitory effects on bone mineralization and engages in binding interactions with activated CD44 and granzyme B (GZMB), highlighting its multifaceted roles in cellular processes and immune regulation.

Verified Bioactivity

Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    CAA34900.1/AAA60179.1 (Y28-L158)

  • Gene ID
    5552  [NCBI]
  • Molecular Construction
    • N-term
    • SRGN (Y28-L158)
      Accession # CAA34900.1/AAA60179.1
    • 10*His
    • C-term
  • Protein Length

    Full Length of Serglycin Chain

  • Synonyms

    SRGN; Proteoglycan 1, Secretory Granule; Prev. PRG1; P.PG; Prev. PRG; Proteoglycan Protein Core For Mast Cell Secretory Granule; PPG; Secretory Granule Proteoglycan Core Peptide; Secretory Granule Proteoglycan Core Protein; Hematopoetic Proteoglycan Core

  • AA Sequence

    YPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

  • Predicted Molecular Mass

    16.1 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×105 units/mg.

  • Serglycin/SRGN Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Serglycin/SRGN Protein, Human (HEK293, His)
  • Experimental Validation Results for Serglycin/SRGN Protein, Human (HEK293, His)
  • Serglycin/SRGN Protein, Human (HEK293, His) Product Image