Serglycin/SRGN Protein, Human (HEK293, His-Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Serine (SRGN) is essential for the formation of mast cell secretory granules and the storage of various compounds. It plays a crucial role in the storage of proteases in mast cells, including granzyme B in T lymphocytes, and contributes to the localization of neutrophil elastase. Serglycin/SRGN Protein, Human (HEK293, His-Myc) is the recombinant human-derived Serglycin/SRGN protein, expressed by HEK293 , with C-His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Serine (SRGN) is essential for the formation of mast cell secretory granules and the storage of various compounds. It plays a crucial role in the storage of proteases in mast cells, including granzyme B in T lymphocytes, and contributes to the localization of neutrophil elastase. Serglycin/SRGN Protein, Human (HEK293, His-Myc) is the recombinant human-derived Serglycin/SRGN protein, expressed by HEK293 , with C-His, C-Myc labeled tag.

Background

Serglycin (SRGN) serves as a crucial player in the formation of mast cell secretory granules, facilitating the storage of various compounds within secretory vesicles. Its indispensability is underscored by its role in storing proteases in connective tissue and mucosal mast cells, including the storage of granzyme B in T-lymphocytes. SRGN also contributes to the localization of neutrophil elastase in azurophil granules of neutrophils. Furthermore, it participates in the processing of MMP2 and, notably, plays a key role in granule-mediated apoptosis by forming a complex with granzyme B. This complex is delivered to cells by perforin, inducing apoptosis. Beyond its involvement in cytotoxic cell granule-mediated processes, SRGN regulates the secretion of TNF-alpha and potentially influences protease secretion. Intriguingly, SRGN exhibits inhibitory effects on bone mineralization and engages in binding interactions with activated CD44 and granzyme B (GZMB), highlighting its multifaceted roles in cellular processes and immune regulation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SRGN (Y28-L158)
      Accession # AAA60179.1
    • Myc-His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SRGN; Proteoglycan 1, Secretory Granule; Prev. PRG1; P.PG; Prev. PRG; Proteoglycan Protein Core For Mast Cell Secretory Granule; PPG; Secretory Granule Proteoglycan Core Peptide; Secretory Granule Proteoglycan Core Protein; Hematopoetic Proteoglycan Core

  • AA Sequence

    YPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

  • Predicted Molecular Mass

    17.3 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00