1. Recombinant Proteins
  2. Others
  3. Serglycin/SRGN Protein, Human (HEK293, His-Myc)

Serglycin/SRGN Protein, Human (HEK293, His-Myc)

Cat. No.: HY-P76058
Handling Instructions Technical Support

Serine (SRGN) is essential for the formation of mast cell secretory granules and the storage of various compounds. It plays a crucial role in the storage of proteases in mast cells, including granzyme B in T lymphocytes, and contributes to the localization of neutrophil elastase. Serglycin/SRGN Protein, Human (HEK293, His-Myc) is the recombinant human-derived Serglycin/SRGN protein, expressed by HEK293 , with C-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Serglycin/SRGN Protein, Human (HEK293, His-Myc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serine (SRGN) is essential for the formation of mast cell secretory granules and the storage of various compounds. It plays a crucial role in the storage of proteases in mast cells, including granzyme B in T lymphocytes, and contributes to the localization of neutrophil elastase. Serglycin/SRGN Protein, Human (HEK293, His-Myc) is the recombinant human-derived Serglycin/SRGN protein, expressed by HEK293 , with C-His, C-Myc labeled tag.

Background

Serglycin (SRGN) serves as a crucial player in the formation of mast cell secretory granules, facilitating the storage of various compounds within secretory vesicles. Its indispensability is underscored by its role in storing proteases in connective tissue and mucosal mast cells, including the storage of granzyme B in T-lymphocytes. SRGN also contributes to the localization of neutrophil elastase in azurophil granules of neutrophils. Furthermore, it participates in the processing of MMP2 and, notably, plays a key role in granule-mediated apoptosis by forming a complex with granzyme B. This complex is delivered to cells by perforin, inducing apoptosis. Beyond its involvement in cytotoxic cell granule-mediated processes, SRGN regulates the secretion of TNF-alpha and potentially influences protease secretion. Intriguingly, SRGN exhibits inhibitory effects on bone mineralization and engages in binding interactions with activated CD44 and granzyme B (GZMB), highlighting its multifaceted roles in cellular processes and immune regulation.

Species

Human

Source

HEK293

Tag

C-His;C-Myc

Accession

AAA60179.1 (Y28-L158)

Gene ID
Molecular Construction
N-term
SRGN (Y28-L158)
Accession # AAA60179.1
Myc-His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Hematopoietic proteoglycan core protein; Platelet proteoglycan core protein; P.PG; SRGN; PRG; PRG1
AA Sequence

YPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

Predicted Molecular Mass
17.3 kDa
Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Serglycin/SRGN Protein, Human (HEK293, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Serglycin/SRGN Protein, Human (HEK293, His-Myc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serglycin/SRGN Protein, Human (HEK293, His-Myc)
Cat. No.:
HY-P76058
Quantity:
MCE Japan Authorized Agent: