SF20/MYDGF Protein, Human (HEK293, His)

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. SF20/MYDGF Protein, Human (HEK293, His) is the recombinant human-derived SF20/MYDGF protein, expressed by HEK293 , with C-His labeled tag. The total length of SF20/MYDGF Protein, Human (HEK293, His) is 142 a.a., with molecular weight of ~17.3 kDa.

MYDGF Protein, a paracrine-acting protein derived from bone marrow monocytes, plays a crucial role in cardiac protection and repair following myocardial infarction (MI). Its multifaceted functions include the promotion of cardiac myocyte survival and the facilitation of adaptive angiogenesis. MYDGF stimulates endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, it inhibits cardiac myocyte apoptosis through a PI3K/AKT-dependent signaling pathway. The protein's involvement in endothelial cell proliferation and angiogenesis underscores its significance in mediating processes crucial for cardiac recovery and tissue repair, making it a potential therapeutic target for cardiovascular conditions.

Measured by its binding ability in a functional ELISA. When Recombinant Human SF20/MYDGF is immobilized at 2 μg/mL. Recombinant Human P4HB binds with an ED₅₀ of 2.292 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human SF20/MYDGF is immobilized at 2 μg/mL, Recombinant Human P4HB binds with an ED₅₀ of 2.292 μg/mL.

Human

HEK293

C-His

Q969H8 (V32-L173)

56005  [NCBI]

VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

Approximately 17.3 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.