TARC/CCL17 Protein, Dog (HEK293, His)

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (HEK293, His) is the recombinant dog-derived TARC/CCL17 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TARC/CCL17 Protein, Dog (HEK293, His) is 76 a.a., with molecular weight of 10.8 kDa.

TARC/CCL17 protein serves as a chemokine with specific chemotactic activity for T lymphocytes, particularly Th2 cells, while exhibiting no such attraction for monocytes or granulocytes. Its involvement extends to various inflammatory and immunological processes, facilitated by the binding to CCR4 on the surface of T cells. Additionally, TARC/CCL17 contributes to GM-CSF/CSF2-driven pain and inflammation. In the brain, this chemokine is crucial for maintaining the characteristic, highly branched morphology of hippocampal microglia under homeostatic conditions and may play a pivotal role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Moreover, TARC/CCL17 plays a significant role in wound healing, primarily by inducing fibroblast migration into the wound.

Dog

HEK293

C-6*His

Q95N01 (A24-S99)

403586  [NCBI]

ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

10.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.