TARC/CCL17 Protein, Mouse (His)

The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity. TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation. TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TARC/CCL17 Protein, Mouse (His) is 70 a.a., with molecular weight of ~10 kDa.

The TARC/CCL17 protein functions as a chemokine with selective chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in various inflammatory and immunological processes. Acting through the binding to CCR4 on the T-cell surface, TARC/CCL17 contributes to orchestrating immune responses. Beyond its immunological functions, it plays a role in GM-CSF/CSF2-driven pain and inflammation. Notably, in the brain, TARC/CCL17 is essential for maintaining the characteristic highly branched morphology of hippocampal microglia under homeostatic conditions and may play a vital role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Additionally, TARC/CCL17 is implicated in wound healing, primarily by inducing fibroblast migration into the wound. This multifaceted functionality highlights the diverse roles of TARC/CCL17 in both immune responses and tissue repair processes.

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ of this effect is 3.462 ng/ml, corresponding to a specific activity is 2.89×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ of this effect is 3.462 ng/ml, corresponding to a specific activity is 2.89×10⁵ units/mg.

Mouse

E. coli

N-6*His

Q9WUZ6 (A24-P93)

20295  [NCBI]

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.