1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL17
  6. TARC/CCL17 Protein, Mouse (His)

The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE TARC/CCL17 Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.

Background

The TARC/CCL17 protein functions as a chemokine with selective chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in various inflammatory and immunological processes. Acting through the binding to CCR4 on the T-cell surface, TARC/CCL17 contributes to orchestrating immune responses. Beyond its immunological functions, it plays a role in GM-CSF/CSF2-driven pain and inflammation. Notably, in the brain, TARC/CCL17 is essential for maintaining the characteristic highly branched morphology of hippocampal microglia under homeostatic conditions and may play a vital role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Additionally, TARC/CCL17 is implicated in wound healing, primarily by inducing fibroblast migration into the wound. This multifaceted functionality highlights the diverse roles of TARC/CCL17 in both immune responses and tissue repair processes.

Biological Activity

1.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 3.462 ng/ml, corresponding to a specific activity is 2.89×105 units/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CCR4. The ED50 for this effect is 1.563ng/mL, corresponding to a specific activity is 6.398×10^5 U/mg.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 3.462 ng/mL, corresponding to a specific activity is 2.89×105 units/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q9WUZ6 (A24-P93)

Gene ID
Molecular Construction
N-term
6*His
CCL17 (A24-P93)
Accession # Q9WUZ6
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-C motif chemokine; CCL17
AA Sequence

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Predicted Molecular Mass
7.9 kDa
Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or 50 mM Tris-HCl, 200 mM NaCl, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TARC/CCL17 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TARC/CCL17 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Mouse (His)
Cat. No.:
HY-P71891A
Quantity:
MCE Japan Authorized Agent: