TARC/CCL17 Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.
The TARC/CCL17 protein functions as a chemokine with selective chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in various inflammatory and immunological processes. Acting through the binding to CCR4 on the T-cell surface, TARC/CCL17 contributes to orchestrating immune responses. Beyond its immunological functions, it plays a role in GM-CSF/CSF2-driven pain and inflammation. Notably, in the brain, TARC/CCL17 is essential for maintaining the characteristic highly branched morphology of hippocampal microglia under homeostatic conditions and may play a vital role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Additionally, TARC/CCL17 is implicated in wound healing, primarily by inducing fibroblast migration into the wound. This multifaceted functionality highlights the diverse roles of TARC/CCL17 in both immune responses and tissue repair processes.
1.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 3.462 ng/ml, corresponding to a specific activity is 2.89×105 units/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CCR4. The ED50 for this effect is 1.563ng/mL, corresponding to a specific activity is 6.398×10^5 U/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Biol Toxicol
SENP3 mediated DeSUMOylation of macrophage derived CCL17 accelerates atherosclerosis via regulation of Treg. [Abstract]2025 Nov 21;41(1):151. PMID: 41266856
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9WUZ6 (A24-P93)
-
Molecular Construction
-
N-term
-
6*His
-
CCL17 (A24-P93)
Accession # Q9WUZ6 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL17; Chemokine (C-C Motif) Ligand 17; Prev. SCYA17; C-C Motif Chemokine 17; TARC; CC Chemokine TARC; ABCD-2; T Cell-Directed CC Chemokine; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 17; A-152E5.3; Thymus And Activation-Regulated Chemokine; C
-
AA Sequence
ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
-
Predicted Molecular Mass
7.9 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or 50 mM Tris-HCl, 200 mM NaCl, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
