TGF alpha/TGFA Protein, Sheep (GST)

TGF α/TGFA protein is a mitogenic polypeptide that synergistically binds EGFR and TGF β to promote anchorage-dependent cell proliferation. Interactions with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, are critical for efficient cell surface targeting. TGF alpha/TGFA Protein, Sheep (GST) is the recombinant sheep-derived TGF alpha/TGFA protein, expressed by E. coli , with N-GST labeled tag. The total length of TGF alpha/TGFA Protein, Sheep (GST) is 74 a.a., with molecular weight of 34.9 kDa.

The TGF alpha/TGFA protein, a mitogenic polypeptide, exhibits the ability to bind to the EGF receptor/EGFR and acts synergistically with TGF beta, promoting anchorage-independent cell proliferation in soft agar. Notably, TGF alpha/TGFA engages in interactions with the PDZ domains of MAGI3, SDCBP, and SNTA1. The association with SDCBP is essential for effective targeting to the cell surface. In its immature form within the endoplasmic reticulum, characterized by a prosegment and lacking full N-glycosylation, TGF alpha/TGFA interacts with CNIH. Furthermore, in the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, through its cytoplasmic C-terminal domain, TGF alpha/TGFA interacts with NKD2, further expanding its potential functional roles in diverse cellular compartments and interactions.

Sheep

E. coli

N-GST

P98135 (E24-Q97)

443307

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

34.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.