1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. TGF-alpha
  5. TGF alpha/TGFA Protein, Sheep (P. pastoris, GST)

TGF alpha/TGFA Protein, Sheep (P. pastoris, GST)

Cat. No.: HY-P700491
Handling Instructions

TGF α/TGFA protein is a mitogenic polypeptide that synergistically binds EGFR and TGF β to promote anchorage-dependent cell proliferation. Interactions with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, are critical for efficient cell surface targeting. TGF alpha/TGFA Protein, Sheep (P. pastoris, GST) is the recombinant sheep-derived TGF alpha/TGFA protein, expressed by P. pastoris , with N-GST labeled tag. The total length of TGF alpha/TGFA Protein, Sheep (P. pastoris, GST) is 74 a.a., with molecular weight of 34.9 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TGF α/TGFA protein is a mitogenic polypeptide that synergistically binds EGFR and TGF β to promote anchorage-dependent cell proliferation. Interactions with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, are critical for efficient cell surface targeting. TGF alpha/TGFA Protein, Sheep (P. pastoris, GST) is the recombinant sheep-derived TGF alpha/TGFA protein, expressed by P. pastoris , with N-GST labeled tag. The total length of TGF alpha/TGFA Protein, Sheep (P. pastoris, GST) is 74 a.a., with molecular weight of 34.9 kDa.

Background

The TGF alpha/TGFA protein, a mitogenic polypeptide, exhibits the ability to bind to the EGF receptor/EGFR and acts synergistically with TGF beta, promoting anchorage-independent cell proliferation in soft agar. Notably, TGF alpha/TGFA engages in interactions with the PDZ domains of MAGI3, SDCBP, and SNTA1. The association with SDCBP is essential for effective targeting to the cell surface. In its immature form within the endoplasmic reticulum, characterized by a prosegment and lacking full N-glycosylation, TGF alpha/TGFA interacts with CNIH. Furthermore, in the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, through its cytoplasmic C-terminal domain, TGF alpha/TGFA interacts with NKD2, further expanding its potential functional roles in diverse cellular compartments and interactions.

Species

Sheep

Source

P. pastoris

Tag

N-GST

Accession

P98135 (E24-Q97)

Gene ID

443307

Molecular Construction
N-term
GST
TGF-α (E24-Q97)
Accession # P98135
C-term
Synonyms
EGF-like TGF; ETGFTGF type 1
AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Molecular Weight

34.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TGF alpha/TGFA Protein, Sheep (P. pastoris, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF alpha/TGFA Protein, Sheep (P. pastoris, GST)
Cat. No.:
HY-P700491
Quantity:
MCE Japan Authorized Agent: