Copy Link Print Information

TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

Background

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, effectively neutralizing its function in osteoclastogenesis. Inhibiting the activation of osteoclasts, it promotes their apoptosis in vitro, highlighting its critical role in bone homeostasis by modulating the local ratio between TNFSF11 and TNFRSF11B. Furthermore, TNFRSF11B may play a role in preventing arterial calcification and act as a decoy receptor for TNFSF10/TRAIL, offering protection against apoptosis. The homodimeric structure of TNFRSF11B underscores its ability to interact with TNFSF10 and TNFSF11, thus regulating essential pathways in bone metabolism and cellular survival.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc;C-Flag
  • Accession

    O00300 (E22-L401)

  • Gene ID
    4982  [NCBI]
  • Molecular Construction
    • N-term
    • TNFRSF11B (E22-L401)
      Accession # O00300
    • hFc-Flag
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TNFRSF11B; Osteoprotegerin; Prev. OPG; Tumor Necrosis Factor Receptor Superfamily, Member 11b; OCIF; Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; PDB5; TNF Receptor Superfamily Member 11b; TR1

  • AA Sequence

    ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

  • Predicted Molecular Mass

    73.5 kDa

  • Molecular Weight

    Approximately 85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) Product Image
    1/16
  • TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) Product Image