TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, effectively neutralizing its function in osteoclastogenesis. Inhibiting the activation of osteoclasts, it promotes their apoptosis in vitro, highlighting its critical role in bone homeostasis by modulating the local ratio between TNFSF11 and TNFRSF11B. Furthermore, TNFRSF11B may play a role in preventing arterial calcification and act as a decoy receptor for TNFSF10/TRAIL, offering protection against apoptosis. The homodimeric structure of TNFRSF11B underscores its ability to interact with TNFSF10 and TNFSF11, thus regulating essential pathways in bone metabolism and cellular survival.

Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC₅₀ is 2.651-7.646 ng/ml.

Human

HEK293

C-hFc;C-Flag

O00300 (E22-L401)

4982  [NCBI]

Full Length of Mature Protein

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Approximately 85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.