TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

TNFRSF11B/OPG functions as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastogenic effects and promoting osteoclast apoptosis in vitro. Crucial for bone homeostasis, it modulates the TNFSF11/TNFRSF11B ratio. Additionally, TNFRSF11B may prevent arterial calcification, acting as a decoy receptor for TNFSF10/TRAIL to inhibit apoptosis. The homodimeric structure enables TNFRSF11B to interact with TNFSF10 and TNFSF11, regulating essential pathways in bone metabolism and cellular survival. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293, with C-hFc, C-Flag labeled tag. The total length of TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is 380 a.a., with molecular weight of 73.5 kDa.

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, effectively neutralizing its function in osteoclastogenesis. Inhibiting the activation of osteoclasts, it promotes their apoptosis in vitro, highlighting its critical role in bone homeostasis by modulating the local ratio between TNFSF11 and TNFRSF11B. Furthermore, TNFRSF11B may play a role in preventing arterial calcification and act as a decoy receptor for TNFSF10/TRAIL, offering protection against apoptosis. The homodimeric structure of TNFRSF11B underscores its ability to interact with TNFSF10 and TNFSF11, thus regulating essential pathways in bone metabolism and cellular survival.

Human

HEK293

C-hFc;C-Flag

O00300 (E22-L401)

4982  [NCBI]

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

73.5 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.