TNFRSF12A Protein, Human (HEK293, Fc)

TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human (HEK293, Fc) is the recombinant human-derived TNFRSF12A protein, expressed by HEK293 , with C-hFc labeled tag.

TNFRSF12A Protein serves as the receptor for TNFSF12/TWEAK and, in certain cell types, acts as a weak inducer of apoptosis. Moreover, it plays a role in promoting angiogenesis and endothelial cell proliferation, and it may modulate cellular adhesion to matrix proteins. The protein associates with TRAF1 and TRAF2, and potentially with TRAF3, indicating its involvement in various cellular signaling pathways.

Human

HEK293

C-hFc

Q9NP84-1 (E28-W79)

51330  [NCBI]

Extracellular Domain

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.