UBE2D1 Protein, Human (GST)

Customer Review

Based on 1 Customer Validation

The UBE2D1 protein is critical in cellular processes. It accepts ubiquitin from the E1 complex and preferentially catalyzes "Lys-48"-linked polyubiquitination in vitro, demonstrating multifunctionality. It mediates the selective degradation of short-lived and aberrant proteins and is involved in E6/E6-AP-induced ubiquitination of p53/TP53. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The UBE2D1 protein is critical in cellular processes. It accepts ubiquitin from the E1 complex and preferentially catalyzes "Lys-48"-linked polyubiquitination in vitro, demonstrating multifunctionality. It mediates the selective degradation of short-lived and aberrant proteins and is involved in E6/E6-AP-induced ubiquitination of p53/TP53. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli , with N-GST labeled tag.

Background

The UBE2D1 protein plays a pivotal role in cellular processes by accepting ubiquitin from the E1 complex and facilitating its covalent attachment to diverse proteins (source). In vitro, UBE2D1 demonstrates a catalytic preference for 'Lys-48'-linked polyubiquitination, showcasing its versatility in modifying target proteins (source). Functioning as a key mediator in the selective degradation of short-lived and aberrant proteins, UBE2D1 also participates in the E6/E6-AP-induced ubiquitination of p53/TP53. Moreover, it facilitates the ubiquitination of PEX5 and orchestrates the auto-ubiquitination of STUB1, TRAF6, and TRIM63/MURF1 (sources). UBE2D1 exhibits the capability to ubiquitinate STUB1-associated HSP90AB1 in vitro, underscoring its involvement in intricate cellular pathways (source). Notably, UBE2D1 lacks inherent specificity for any particular lysine residue of ubiquitin, highlighting its dynamic nature in ubiquitin modification processes (source). Its essential role in viral activation of IRF3 and mediation of the polyubiquitination of CYP3A4 further emphasizes UBE2D1's multifaceted contributions to cellular function (sources).

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • UBE2D1 (M1-M147)
      Accession # P51668
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2D1; Ubiquitin Conjugating Enzyme E2 D1; SFT; UBCH5; Stimulator Of Fe Transport; E2(17)KB1; UbcH5A; UBC4/5; Ubiquitin-Conjugating Enzyme E2D 1 (UBC4/5 Homolog,Yeast); (E3-Independent) E2 Ubiquitin-Conjugating Enzyme D1; Ubiquitin-Conjugating Enzyme E2-

  • AA Sequence

    MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

  • Predicted Molecular Mass

    42.9 kDa

  • Molecular Weight

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerin, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00