UBE2D1 Protein, Human (GST)

UBE2D1 Protein, crucial in cellular processes, accepts ubiquitin from the E1 complex, preferentially catalyzing 'Lys-48'-linked polyubiquitination in vitro, showcasing versatility. It mediates selective degradation of short-lived and aberrant proteins and participates in E6/E6-AP-induced p53/TP53 ubiquitination. UBE2D1 facilitates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6, and TRIM63/MURF1. It ubiquitinates STUB1-associated HSP90AB1 in vitro, highlighting involvement in cellular pathways. Lacking inherent specificity for any ubiquitin lysine residue, UBE2D1's dynamic nature in ubiquitin modification processes is notable. Its essential role in viral activation of IRF3 and mediation of CYP3A4 polyubiquitination emphasizes multifaceted contributions to cellular function. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2D1 Protein, Human (GST) is 147 a.a., with molecular weight of ~40.0 kDa.

The UBE2D1 protein plays a pivotal role in cellular processes by accepting ubiquitin from the E1 complex and facilitating its covalent attachment to diverse proteins (source). In vitro, UBE2D1 demonstrates a catalytic preference for 'Lys-48'-linked polyubiquitination, showcasing its versatility in modifying target proteins (source). Functioning as a key mediator in the selective degradation of short-lived and aberrant proteins, UBE2D1 also participates in the E6/E6-AP-induced ubiquitination of p53/TP53. Moreover, it facilitates the ubiquitination of PEX5 and orchestrates the auto-ubiquitination of STUB1, TRAF6, and TRIM63/MURF1 (sources). UBE2D1 exhibits the capability to ubiquitinate STUB1-associated HSP90AB1 in vitro, underscoring its involvement in intricate cellular pathways (source). Notably, UBE2D1 lacks inherent specificity for any particular lysine residue of ubiquitin, highlighting its dynamic nature in ubiquitin modification processes (source). Its essential role in viral activation of IRF3 and mediation of the polyubiquitination of CYP3A4 further emphasizes UBE2D1's multifaceted contributions to cellular function (sources).

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-GST

P51668 (M1-M147)

7321  [NCBI]

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerin, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.