USP14 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

Background

USP14, a proteasome-associated deubiquitinase, emerges as a crucial player in cellular processes, particularly in the dynamic regulation of ubiquitin at the proteasome. Functioning as a reversibly associated subunit of the proteasome, USP14 ensures the release of ubiquitin from ubiquitinated proteins targeted for degradation, facilitating the regeneration of ubiquitin within the cellular environment. Beyond its role in proteasome-mediated protein turnover, USP14 plays a pivotal role in diverse physiological contexts. It is involved in the degradation of the chemokine receptor CXCR4, a critical event for CXCL12-induced cell chemotaxis. Additionally, USP14 serves as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under non-stressed conditions, interacting with ERN1 and modulating the degradation of unfolded endoplasmic reticulum proteins. Furthermore, USP14 contributes to synaptic development and function at neuromuscular junctions (NMJs) and participates in the innate immune defense against viruses by stabilizing the viral DNA sensor CGAS, thereby impeding its autophagic degradation.

Verified Bioactivity

1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 13.76 ng/mL, corresponding to a specific activity is 7.27×104 units/mg.
2.Measured by the hydrolysis of Ubiquitin-AMC that incubate at 37℃ in kinetic mode for 40 minutes. The specific activity is 2.858 pmol/min/μg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • USP14 (D91-Q494)
      Accession # P54578-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    USP14; Ubiquitin Specific Peptidase 14; TGT; Ubp6; Ubiquitin Specific Peptidase 14 (TRNA‑Guanine Transglycosylase); Ubiquitin Specific Protease 14 (TRNA‑Guanine Transglycosylase); Ubiquitin Carboxyl‑Terminal Hydrolase 14; Deubiquitinating Enzyme 14; Ubiqu

  • AA Sequence

    DMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

  • Predicted Molecular Mass

    46.2 kDa

  • Molecular Weight

    Approximately 52 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00