1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Deubiquitinase
  4. Ubiquitin-Specific Protease
  5. Ubiquitin-Specific Peptidase 14
  6. USP14 Protein, Human (His)

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE USP14 Protein, Human (His)

  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (His) is the recombinant human-derived USP14 protein, expressed by E. coli , with N-6*His labeled tag.

Background

USP14, a proteasome-associated deubiquitinase, emerges as a crucial player in cellular processes, particularly in the dynamic regulation of ubiquitin at the proteasome. Functioning as a reversibly associated subunit of the proteasome, USP14 ensures the release of ubiquitin from ubiquitinated proteins targeted for degradation, facilitating the regeneration of ubiquitin within the cellular environment. Beyond its role in proteasome-mediated protein turnover, USP14 plays a pivotal role in diverse physiological contexts. It is involved in the degradation of the chemokine receptor CXCR4, a critical event for CXCL12-induced cell chemotaxis. Additionally, USP14 serves as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under non-stressed conditions, interacting with ERN1 and modulating the degradation of unfolded endoplasmic reticulum proteins. Furthermore, USP14 contributes to synaptic development and function at neuromuscular junctions (NMJs) and participates in the innate immune defense against viruses by stabilizing the viral DNA sensor CGAS, thereby impeding its autophagic degradation.

Actividad biológica

1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 13.76 ng/mL, corresponding to a specific activity is 7.27×104 units/mg.
2.Measured by the hydrolysis of Ubiquitin-AMC that incubate at 37℃ in kinetic mode for 40 minutes. The specific activity is 2.858 pmol/min/μg.

  • Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 13.76 ng/mL, corresponding to a specific activity is 7.27×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P54578-1 (D91-Q494)

Gene ID
Molecular Construction
N-term
6*His
USP14 (D91-Q494)
Accession # P54578-1
C-term
Protein Length

Partial

Synonyms
Ubiquitin Carboxyl-Terminal Hydrolase 14; Deubiquitinating Enzyme 14; Ubiquitin Thioesterase 14; Ubiquitin-Specific-Processing Protease 14; USP14; TGT
AA Sequence

DMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Predicted Molecular Mass
46.2 kDa
Peso molecular

Approximately 52 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

USP14 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
USP14 Protein, Human (His)
Cat. No.:
HY-P71418
Cantidad:
MCE Japan Authorized Agent: