2. Anti-infection
  3. Bacterial Antibiotic
  4. Cecropin A

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Cecropin A Chemical Structure

Cecropin A Chemical Structure

CAS No. : 80451-04-3

Size Price Stock Quantity
1 mg USD 150 In-stock
5 mg USD 450 In-stock
10 mg USD 650 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Cecropin A:

Cecropin A Related Antibodies

Top Publications Citing Use of Products

View All Antibiotic Isoform Specific Products:

View All Isoforms

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

IC50 & Target

Bacterial[2]
In Vitro

Cecropin A shows anticancer activity. Cecropin A (10-50 μM) dose-dependently reduces the viability of HL-60 cells. Cecropin A (30 μM) promotes ROS production, causes mitochondrial membrane potential (Δψm) collapse, and generates morphological changes in nuclear chromatin in HL-60 cells. Cecropin A (30 μM) also leads to an early apoptosis and cuases caspase-independent cell death in HL-60 cells[1]. Cecropin A has cytotoxicity on gram negative bacteria, including A. baumanii (CCARM 12005, CCARM 12035, CCARM 12036, CCARM 12037) with minimal inhibitory concentration (MIC) of 0.5-1 μM. Cecropin A (25 μM) significantly blocks the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibited the expression of mMIP-1 mRNA in RAW264.7 cells. Cecropin A (0.1, 0.25, 0.5, 1, 2.5, 5 μM) also inhibits NO production and reduces mTNF-α cytokine levels in LPS-stimulated RAW264.7 cells, and exihibits anti-inflammatory activity[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cecropin A Related Antibodies
Molecular Weight

4003.78

Formula

C184H313N53O46
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
Sequence Shortening

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 20 mg/mL (5.00 mM; ultrasonic and adjust pH to 5 with HCl)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2498 mL 1.2488 mL 2.4976 mL
5 mM 0.0500 mL 0.2498 mL 0.4995 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Cell Assay
[1]

Briefly, 5 × 105 cells/mL in RPMI 1640 supplemented with 10% heat-inactivated FCS are placed onto 96-well plates. Cecropin A is added to cell cultures at a final concentration of 10, 20, 30, 40 and 50 μM and cells are incubated for 24 h at 37°C in a humidified atmosphere with 5% CO2. Then, 20 μL MTT (0.5 mg/mL) is added to each well and the plate is incubated for 4 h at 37°C. The MTT solution is removed and isopropyl alcohol containing 0.04 N hydrochloric acid is added to each well to dissolve the formazan crystal. Absorbance is determined on a spectrophotometric microplate reader at a test wavelength of 550 nm and a reference wavelength of 620 nm. The absorbance of the cells incubated in the absence of cecropin A (untreated cells) is set at 100%. Results are expressed as percentage of cell viability[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2498 mL 1.2488 mL 2.4976 mL 6.2441 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Cecropin A Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Cecropin A80451-04-3BacterialAntibioticInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cecropin A
Cat. No.:
HY-P1539
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.