GIP, human
Based on 2 publication(s) in Google Scholar
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.
For research use only. We do not sell to patients.
- Purity: 99.94%
- CAS No.: 100040-31-1
- Formula: C226H338N60O66S
- Molecular Weight:4983.60
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) GIP, human
More
Customer Validation & Images
-
Histological Imaging/Staining
-
ELISA
-
Cell Proliferation/Viability Assay
-
Flow Cytometry
-
IF
Biological Activity
Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 100040-31-1
-
Appearance Solid
-
Molecular Weight 4983.60
-
Formula C226H338N60O66S
-
Color White to off-white
-
Synonyms
Gastric Inhibitory Peptide (GIP), human
-
Sequence
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
-
Sequence Shortening
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Toxins
Deoxynivalenol (Vomitoxin)-Induced Anorexia Is Induced by the Release of Intestinal Hormones in Mice. [Abstract]2021 Jul 22;13(8):512. PMID: 34437383 -
Gynecol Endocrinol
Glucose-dependent insulinotropic peptide (GIP) suppresses androgen biosynthesis in PCOS mouse models and cellular systems. [Abstract]2025 Dec 31;41(1):2582506. PMID: 41249890
GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).
GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.
GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (10-7 and 10-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.
GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (10-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.
GIP, human purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]
GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.
Solvent & Solubility
H2O : 25 mg/mL (5.02 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (286 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13. [Content Brief]
[2]. Miyachi A, et al. Quantitative analytical method for determining the levels of gastric inhibitory polypeptides GIP1-42 and GIP3-42 in human plasma using LC-MS/MS/MS. J Proteome Res. 2013;12(6):2690-2699. [Content Brief]
[3]. Gabe MBN, et al. Molecular interactions of full-length and truncated GIP peptides with the GIP receptor - A comprehensive review. Peptides. 2020;125:170224. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2007 mL | 1.0033 mL | 2.0066 mL | 5.0165 mL |
| 5 mM | 0.0401 mL | 0.2007 mL | 0.4013 mL | 1.0033 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
GIP, human Related Classifications
HY-P0276 Related Classifications
Powered by Bioz