1. GPCR/G Protein
    Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Neuropeptide Y (29-64), amide, human TFA

Neuropeptide Y (29-64), amide, human TFA 

Cat. No.: HY-P0198A Purity: 95.02%
Handling Instructions

Neuropeptide Y (29-64), amide, human (TFA) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (29-64), amide, human TFA Chemical Structure

Neuropeptide Y (29-64), amide, human TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 180 In-stock
Estimated Time of Arrival: December 31
5 mg USD 720 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Neuropeptide Y (29-64), amide, human TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Neuropeptide Y (29-64), amide, human (TFA) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

In Vitro

It is showed that Neuropeptide Y (29-64), amide, human (TFA) is able to protect cortical neurons from Aβ25-35 toxicity. 2 μM NPY abolishes the toxic effects of Aβ25-35 at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (29-64), amide, human (TFA) pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human (TFA) Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ35-25[1].

Molecular Weight

4385.70

Formula

C₁₉₁H₂₈₆F₃N₅₅O₅₉S

Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere

Storage
Protect from light, stored under nitrogen
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
References
Cell Assay
[1]

Primary cortical neurons are preincubated either alone (positive control) or with three concentrations of Neuropeptide Y (29-64), amide, human (TFA) (NPY) (0.5, 1, and 2 μM) for 24 h and then exposed to Aβ25-35 (50 μM) or Aβ35-25 (50 μM) for 48 h[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropeptide Y (29-64), amide, human TFA
Cat. No.:
HY-P0198A
Quantity: