Neuropeptide Y (human) (TFA)

Cat. No.: HY-P0198A Purity: 95.34%: FAQs
Data Sheet SDS COA Handling Instructions

Neuropeptide Y (human) TFA is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (human) (TFA) Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 180	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 720	In-stock	Estimated Time of Arrival: December 31
10 mg		Get quote
50 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Neuropeptide Y (human) (TFA):

Neuropeptide Y (human) Get quote
[D-Arg25]-Neuropeptide Y (human) Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description

Neuropeptide Y (human) TFA is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

In Vitro

It is showed that Neuropeptide Y (human) is able to protect cortical neurons from Aβ_25-35 toxicity. 2 μM NPY abolishes the toxic effects of Aβ_25-35 at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (human) pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human (TFA) Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ_35-25^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4385.70

Appearance

Solid

Formula

C₁₉₁H₂₈₆F₃N₅₅O₅₉S

Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility

In Vitro:

H₂O : 100 mg/mL (22.80 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2280 mL	1.1401 mL	2.2801 mL
5 mM	0.0456 mL	0.2280 mL	0.4560 mL
10 mM	0.0228 mL	0.1140 mL	0.2280 mL

*Please refer to the solubility information to select the appropriate solvent.

In Vivo:

1.

Add each solvent one by one: PBS
Solubility: 100 mg/mL (22.80 mM); Clear solution; Need ultrasonic

*All of the co-solvents are available by MCE.

Purity & Documentation

Purity: 95.34%

Select Batch:

Data Sheet (269 KB) SDS (252 KB)

COA (240 KB) RP-HPLC (209 KB) Elemental Analysis Report (100 KB)

Handling Instructions (2659 KB)

References

[1]. Croce N, et al. Neuropeptide Y protects rat cortical neurons against β-amyloid toxicity and re-establishes synthesis and release of nerve growth factor. ACS Chem Neurosci. 2012 Apr 18;3(4):312-8. [Content Brief]

Cell Assay ^[1]	Primary cortical neurons are preincubated either alone (positive control) or with three concentrations of Neuropeptide Y (human) (NPY) (0.5, 1, and 2 μM) for 24 h and then exposed to Aβ_25-35 (50 μM) or Aβ_35-25 (50 μM) for 48 h^[1]. MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References	[1]. Croce N, et al. Neuropeptide Y protects rat cortical neurons against β-amyloid toxicity and re-establishes synthesis and release of nerve growth factor. ACS Chem Neurosci. 2012 Apr 18;3(4):312-8. [Content Brief]