1. GPCR/G Protein
    Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Neuropeptide Y (29-64), amide, human

Neuropeptide Y (29-64), amide, human (Synonyms: Human neuropeptide Y (29-64))

Cat. No.: HY-P0198
Handling Instructions

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (29-64), amide, human Chemical Structure

Neuropeptide Y (29-64), amide, human Chemical Structure

CAS No. : 90880-35-6

Size Price Stock
1 mg USD 180 Ask For Quote & Lead Time
5 mg USD 720 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Other In-stock Forms of Neuropeptide Y (29-64), amide, human:

Other Forms of Neuropeptide Y (29-64), amide, human:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

In Vitro

Neuropeptide Y (29-64), amide, human is a 36 amino acid neurotransmitter found in the brain and autonomic nervous system. Neuropeptide Y (29-64), amide, human has been associated with numerous physiologic processes in the brain, including the regulation of energy balance, memory and learning, and epilepsy.

Molecular Weight

4271.68

Formula

C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.

90880-35-6

Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropeptide Y (29-64), amide, human
Cat. No.:
HY-P0198
Quantity: