Neuropeptide Y (human,rat,mouse)
Based on 3 publication(s) in Google Scholar
Neuropeptide Y (human,rat,mouse) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.
For research use only. We do not sell to patients.
- Purity: 99.94%
- CAS No.: 90880-35-6
- Formula: C189H285N55O57S
- Molecular Weight:4271.68
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Neuropeptide Y (human,rat,mouse)
MoreAll Neuropeptide Y Receptor Isoforms
More
Biological Activity
Description
In Vitro
It is showed that Neuropeptide Y (human,rat,mouse) is able to protect cortical neurons from Aβ25-35 toxicity. 2 μM NPY abolishes the toxic effects of Aβ25-35 at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (human) pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human (TFA) Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ35-25[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 90880-35-6
-
Appearance Solid
-
Molecular Weight 4271.68
-
Formula C189H285N55O57S
-
Color White to off-white
-
Synonyms
Neuropeptide Y (29-64), amide
-
Sequence
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
-
Sequence Shortening
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
Neuropeptide Y neurons mediate opioid-induced itch by disinhibiting GRP-GRPR microcircuits in the spinal cord. [Abstract]2025 Aug 1;16(1):7074. PMID: 40750771 -
Adv Sci (Weinh)
2024 Sep;11(34):e2400196. PMID: 38978353 -
Brain
2026 Feb 25:awag077. PMID: 41738433
Solvent & Solubility
In Vitro:
H2O : 100 mg/mL (23.41 mM; Need ultrasonic)
DMSO : 25 mg/mL (5.85 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocol
Cell Assay[1]
Primary cortical neurons are preincubated either alone (positive control) or with three concentrations of Neuropeptide Y (human) (NPY) (0.5, 1, and 2 μM) for 24 h and then exposed to Aβ25-35 (50 μM) or Aβ35-25 (50 μM) for 48 h[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Purity & Documentation
-
Data Sheet (285 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.2341 mL | 1.1705 mL | 2.3410 mL | 5.8525 mL |
| 5 mM | 0.0468 mL | 0.2341 mL | 0.4682 mL | 1.1705 mL | |
| H2O | 10 mM | 0.0234 mL | 0.1170 mL | 0.2341 mL | 0.5852 mL |
| 15 mM | 0.0156 mL | 0.0780 mL | 0.1561 mL | 0.3902 mL | |
| 20 mM | 0.0117 mL | 0.0585 mL | 0.1170 mL | 0.2926 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.