Neuropeptide Y (3-36) (human, rat)
Based on 1 publication(s) in Google Scholar
Neuropeptide Y (3-36) (human, rat) is a neuropeptide Y fragment derived from humans or rats. Neuropeptide Y is an extremely abundant neurotransmitter in central and peripheral neurons, and it participates in the regulation of psychomotor activity, circadian rhythm, feeding behavior and cardiovascular function. Neuropeptide Y (3-36) (human, rat) can serve as a substrate to be sequentially degraded from its N-terminus by AfuS28, and it requires binding to AfuS28 and SedB to be decomposed into amino acids, dipeptides and tripeptides[1][2].
For research use only. We do not sell to patients.
- Purity: 96.94%
- CAS No.: 150138-78-6
- Formula: C175H269N53O54S
- Molecular Weight:4011.50
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
-
HY-P0198
Neuropeptide Y (human,rat,mouse)
-
HY-14450
JNJ-31020028
-
HY-120619
BMS-193885
-
HY-P1514
Peptide YY (PYY), human
-
HY-P1480
Neuropeptide Y (13-36), amide, human
-
![[cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide](https://file.medchemexpress.com/product_pic/hy-p1324.gif)
HY-P1324
[cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide
-
HY-P1205
MCH(human, mouse, rat)
-
HY-P1532
Pancreatic Polypeptide, rat
-
![[Leu31,Pro34]-Neuropeptide Y (human,rat,mouse)](https://file.medchemexpress.com/product_pic/hy-p1323.gif)
HY-P1323
[Leu31,Pro34]-Neuropeptide Y (human,rat,mouse)
-
HY-P1248
Neuropeptide FF
-
HY-P1249
Neuropeptide SF(mouse,rat)
-
HY-101986
BIIE-0246
Publications Citing Use of MedChemExpress (MCE) Neuropeptide Y (3-36) (human, rat)
MoreAll Neuropeptide Y Receptor Isoforms
More
Biological Activity
|
NPY Y2 receptor |
Combined treatment with recombinant Aspergillus fumigatus AfuS28 and SedB proteases (4.8 nmol NPY 3-36; 1 h) degrades human/rat Neuropeptide Y (3-36) into single amino acids, dipeptides, and tripeptides after 1 h of incubation at 37 °C in acidic buffer[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 150138-78-6
-
Appearance Solid
-
Molecular Weight 4011.50
-
Formula C175H269N53O54S
-
Color White to off-white
-
Sequence
Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
-
Sequence Shortening
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvent & Solubility
DMSO : 100 mg/mL (24.93 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (284 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Grandt D, et al. Neuropeptide Y 3-36 is an endogenous ligand selective for Y2 receptors. Regul Pept. 1996;67(1):33-37. [Content Brief]
[2]. Sriranganadane D, et al. Aspergillus protein degradation pathways with different secreted protease sets at neutral and acidic pH. J Proteome Res. 2010;9(7):3511-3519. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2493 mL | 1.2464 mL | 2.4928 mL | 6.2321 mL |
| 5 mM | 0.0499 mL | 0.2493 mL | 0.4986 mL | 1.2464 mL | |
| 10 mM | 0.0249 mL | 0.1246 mL | 0.2493 mL | 0.6232 mL | |
| 15 mM | 0.0166 mL | 0.0831 mL | 0.1662 mL | 0.4155 mL | |
| 20 mM | 0.0125 mL | 0.0623 mL | 0.1246 mL | 0.3116 mL |
Neuropeptide Y (3-36) (human, rat) Related Classifications
HY-P2543 Related Classifications
Powered by Bioz