Peptide YY (PYY), human

Name: Peptide YY (PYY), human
Brand: MedChemExpress
SKU: HY-P1514
Rating: 4.5 (1 reviews)

Cat. No.: HY-P1514 Purity: 99.77%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (PYY), human Chemical Structure

CAS No. : 118997-30-1

Size	Price	Stock	Quantity
1 mg	USD 80	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 240	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 385	Get quote	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.

IC₅₀ & Target

Neuropeptide Y receptor^[1]

In Vitro

The gut hormone peptide YY ( PYY) belongs to the pancreatic polypeptide (PP) family along with PP and neuropeptide Y (NPY). These peptides mediate their effects through the NPY receptors of which there are several subtypes (Y1, Y2, Y4, and Y5)^[1]. Pancreatic polypeptide YY (Peptide YY), a small peptide consisting of 36 amino acids, is originally isolated from porcine intestine and is secreted from the neuroendocrine cells (L cells) in the mucosa of the gastrointestinal tract, but it has been localized to other locations associated with the digestive system^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Peptide YY is capable of strongly inhibiting secretin-stimulated pancreatic secretion. A very low dose of Peptide YY (10-20 pmol/kg) significantly decreases the pancreatic secretion of bicarbonate as well as fluid that is stimulated by a single dose of secretin (0.1 unit/kg). A dose of Peptide YY of 100-200 pmol/kg causes a 70-80% reduction of the pancreatic bicarbonate and fluid secretion^[3]. Peptide YY is localised to blood vessels and atherosclerotic plaques of rabbits. It causes vasoconstriction of the vascular tree^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4309.75

Formula

C₁₉₄H₂₉₅N₅₅O₅₇

CAS No.

118997-30-1

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation

Purity: 99.77%

Select Batch:

Data Sheet (265 KB) SDS (252 KB)

COA (242 KB) RP-HPLC (109 KB) MS (190 KB) Elemental Analysis Report (99 KB)

Handling Instructions (2659 KB)

References

[1]. Peptide YY, et al. The gut hormone peptide YY regulates appetite. Ann N Y Acad Sci. 2003 Jun;994:162-8. [Content Brief]

[2]. Tatemoto K, et al. Isolation and characterization of peptide YY (PYY ), a candidate gut hormone that inhibits pancreatic exocrine secretion. Proc Natl Acad Sci U S A. 1982 Apr;79(8):2514-8. [Content Brief]

[3]. Smith RM, et al. Role of Peptide YY in blood vessel function and atherosclerosis in a rabbit model. Clin Exp Pharmacol Physiol. 2015 Jun;42(6):648-52. [Content Brief]

Animal Administration
^[2]^[3]

Cats^[3]

The inhibitory effects of Peptide YY on pancreatic exocrine secretion are studied by using an anesthetized adult (4 kg) cat. Infusion of secretin and CCK (1.5 units/ kg/hr each) in saline solution is made through the saphenous vein by using a perfusion pump at a flow rate of 10 ml/hr. Infusion or single injection of Peptide YY (10-250 pmol/kg) is also made through the saphenous vein. Pancreatic juice from the cannulated pancreatic duct is collected in test tubes for 10-min periods by using a fraction collector. The volume of the juice and A280 are measured. Bicarbonate is determined by the titration method^[3].

Rabbits^[2]

New Zealand White rabbits are fed an atherogenic diet and control animals fed a normal diet for 4 weeks. Immunohistochemistry is used to determine the localization of Peptide YY and eNOS in the aorta. The aorta, carotid, renal, iliac, inferior mesenteric, and renal interlobular arteries are removed, mounted in organ baths, and subjected to doses of Peptide YY (1-100 nM) and then acetylcholine (1 μM)^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

[1]. Peptide YY, et al. The gut hormone peptide YY regulates appetite. Ann N Y Acad Sci. 2003 Jun;994:162-8. [Content Brief]

[2]. Tatemoto K, et al. Isolation and characterization of peptide YY (PYY ), a candidate gut hormone that inhibits pancreatic exocrine secretion. Proc Natl Acad Sci U S A. 1982 Apr;79(8):2514-8. [Content Brief]

[3]. Smith RM, et al. Role of Peptide YY in blood vessel function and atherosclerosis in a rabbit model. Clin Exp Pharmacol Physiol. 2015 Jun;42(6):648-52. [Content Brief]