1. GPCR/G Protein
  2. Neuropeptide Y Receptor

Peptide YY (PYY), human 

Cat. No.: HY-P1514
Handling Instructions

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors. Sequence: Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (PYY), human Chemical Structure

Peptide YY (PYY), human Chemical Structure

CAS No. : 118997-30-1

Size Price Stock
500 μg USD 160 Get quote
1 mg USD 260 Get quote
5 mg USD 960 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References

Description

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors. Sequence: Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2.

IC50 & Target

Neuropeptide Y receptor[1]

In Vitro

The gut hormone peptide YY ( PYY) belongs to the pancreatic polypeptide (PP) family along with PP and neuropeptide Y (NPY). These peptides mediate their effects through the NPY receptors of which there are several subtypes (Y1, Y2, Y4, and Y5)[1]. Pancreatic polypeptide YY (Peptide YY), a small peptide consisting of 36 amino acids, is originally isolated from porcine intestine and is secreted from the neuroendocrine cells (L cells) in the mucosa of the gastrointestinal tract, but it has been localized to other locations associated with the digestive system[2].

In Vivo

Peptide YY is capable of strongly inhibiting secretin-stimulated pancreatic secretion. A very low dose of Peptide YY (10-20 pmol/kg) significantly decreases the pancreatic secretion of bicarbonate as well as fluid that is stimulated by a single dose of secretin (0.1 unit/kg). A dose of Peptide YY of 100-200 pmol/kg causes a 70-80% reduction of the pancreatic bicarbonate and fluid secretion[3]. Peptide YY is localised to blood vessels and atherosclerotic plaques of rabbits. It causes vasoconstriction of the vascular tree[2].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2320 mL 1.1602 mL 2.3203 mL
5 mM 0.0464 mL 0.2320 mL 0.4641 mL
10 mM 0.0232 mL 0.1160 mL 0.2320 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Animal Administration
[2][3]

Cats[3]

The inhibitory effects of Peptide YY on pancreatic exocrine secretion are studied by using an anesthetized adult (4 kg) cat. Infusion of secretin and CCK (1.5 units/ kg/hr each) in saline solution is made through the saphenous vein by using a perfusion pump at a flow rate of 10 ml/hr. Infusion or single injection of Peptide YY (10-250 pmol/kg) is also made through the saphenous vein. Pancreatic juice from the cannulated pancreatic duct is collected in test tubes for 10-min periods by using a fraction collector. The volume of the juice and A280 are measured. Bicarbonate is determined by the titration method[3].

Rabbits[2]

New Zealand White rabbits are fed an atherogenic diet and control animals fed a normal diet for 4 weeks. Immunohistochemistry is used to determine the localization of Peptide YY and eNOS in the aorta. The aorta, carotid, renal, iliac, inferior mesenteric, and renal interlobular arteries are removed, mounted in organ baths, and subjected to doses of Peptide YY (1-100 nM) and then acetylcholine (1 μM)[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
Molecular Weight

4309.75

Formula

C₁₉₄H₂₉₅N₅₅O₅₇

CAS No.

118997-30-1

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peptide YY (PYY), human
Cat. No.:
HY-P1514
Quantity:

Peptide YY (PYY), human

Cat. No.: HY-P1514