1. Anti-infection
  2. SARS-CoV
  3. Aviptadil

Aviptadil  (Synonyms: Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine))

Cat. No.: HY-P0012 Purity: 99.81%
COA Handling Instructions

Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Aviptadil Chemical Structure

Aviptadil Chemical Structure

CAS No. : 40077-57-4

Size Price Stock Quantity
1 mg USD 144 In-stock
5 mg USD 300 In-stock
10 mg USD 420 In-stock
50 mg USD 780 In-stock
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Aviptadil:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Aviptadil

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al[1][2].

Clinical Trial
Molecular Weight

3325.80

Appearance

Solid

Formula

C147H238N44O42S

CAS No.
Sequence Shortening

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (30.07 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3007 mL 1.5034 mL 3.0068 mL
5 mM 0.0601 mL 0.3007 mL 0.6014 mL
10 mM 0.0301 mL 0.1503 mL 0.3007 mL
*Please refer to the solubility information to select the appropriate solvent.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Aviptadil Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Aviptadil
Cat. No.:
HY-P0012
Quantity:
MCE Japan Authorized Agent: