1. Peptides
  2. Aviptadil

Aviptadil (Synonyms: Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine))

Cat. No.: HY-P0012 Purity: 97.18%
Handling Instructions

Aviptadil (INN) is an analog of vasoactive intestinal polypeptide (VIP) for the treatment of erectile dysfunction.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Aviptadil Chemical Structure

Aviptadil Chemical Structure

CAS No. : 40077-57-4

Size Price Stock Quantity
10 mM * 1 mL in Water USD 571 In-stock
Estimated Time of Arrival: December 31
1 mg USD 144 In-stock
Estimated Time of Arrival: December 31
5 mg USD 300 In-stock
Estimated Time of Arrival: December 31
10 mg USD 420 In-stock
Estimated Time of Arrival: December 31
50 mg USD 780 In-stock
Estimated Time of Arrival: December 31
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Aviptadil (INN) is an analog of vasoactive intestinal polypeptide (VIP) for the treatment of erectile dysfunction.

Molecular Weight

3325.80

Formula

C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.

40077-57-4

Sequence

His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

Sequence Shortening

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Solvent & Solubility
In Vitro: 

H2O : ≥ 65 mg/mL (19.54 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3007 mL 1.5034 mL 3.0068 mL
5 mM 0.0601 mL 0.3007 mL 0.6014 mL
10 mM 0.0301 mL 0.1503 mL 0.3007 mL
*Please refer to the solubility information to select the appropriate solvent.
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

AviptadilVasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine)OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Aviptadil
Cat. No.:
HY-P0012
Quantity:
MCE Japan Authorized Agent: