1. Anti-infection
  2. SARS-CoV
  3. Aviptadil acetate

Aviptadil acetate (Synonyms: Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine))

Cat. No.: HY-P0012A Purity: 99.09%
Handling Instructions

Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Aviptadil acetate Chemical Structure

Aviptadil acetate Chemical Structure

CAS No. : 1444827-29-5

Size Price Stock Quantity
5 mg USD 220 In-stock
Estimated Time of Arrival: December 31
10 mg USD 350 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Aviptadil acetate:

Top Publications Citing Use of Products

Publications Citing Use of MCE Aviptadil acetate

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al[1].

In Vitro

Aviptadil acetate inhibits the basal proliferation of pulmonary arterial smooth muscle cells (PASMC) and the mobilization of intracellular free calcium concentration in these cells in a dose-dependent manner[3].
Aviptadil acetate (1 nM-10 μM) produces a concentration-dependent inhibition of CSE-induced cell death in L2 cells. At 10 μM, Aviptadil acetate reduces CSE-stimulated MMP activity and caspase-3 activation in L2 cells[1].
Aviptadil acetate (10 nM-100 μM) attenuates lipopolisaccharide (LPS)-induced MMP-9 activity and its expression by alveolar macrophages (AM) in rats[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Aviptadil acetate (1, 3 and 10 mg/kg; intravenous bolus injection) is injected into a tail vein. No-effect dose level is 1 mg/kg. Dose level with first intolerance reactions 3 mg/kg, Lowest lethal dose level is >10 mg/kg. i.v. LD50 of Aviptadil is >10 mg/kg in males, females and male and female combined after 24 hours and 14 days[3].
Aviptadil acetate (intravenous bolus injection) at 3 mg causes slightly reduced motility, slight ataxia and slight dyspnoea in all 5 male and 5 female animals 15 to 30 minutes after administration. At 10 mg, Aviptadil reveals slightly reduced motility, slight ataxia, and slight dyspnoea 15 to 60 minutes and slightly reduces muscle tone 15 to 30 minutes after administration, respectively, in all male and female animals[3].
Nose-only inhalation exposure of CD1 mice to aerosolized.
Aviptadil acetate at a dose of 1546 µg/kg/day is well tolerated and produces no apparent changes in any of the parameters evaluated. No changes are observed after a single dose administration as high as 3920 µg/kg/day. The no-observable-adverse-effect level (NOAEL) is considered to be at least 3920 µg/kg/day fore an acute exposure and 1546 µg/kg/day for a 10 day repeated exposure[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3385.90

Formula

C₁₄₇H₂₃₈N₄₄O₄₂S.C₂H₄O₂

CAS No.

1444827-29-5

Sequence Shortening

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Protect from light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (protect from light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (29.53 mM; Need ultrasonic)

H2O : 100 mg/mL (29.53 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2953 mL 1.4767 mL 2.9534 mL
5 mM 0.0591 mL 0.2953 mL 0.5907 mL
10 mM 0.0295 mL 0.1477 mL 0.2953 mL
*Please refer to the solubility information to select the appropriate solvent.
In Vivo:
  • 1.

    Add each solvent one by one:  10% DMSO    40% PEG300    5% Tween-80    45% saline

    Solubility: ≥ 2.5 mg/mL (0.74 mM); Clear solution

  • 2.

    Add each solvent one by one:  10% DMSO    90% (20% SBE-β-CD in saline)

    Solubility: 2.5 mg/mL (0.74 mM); Suspended solution; Need ultrasonic

  • 3.

    Add each solvent one by one:  10% DMSO    90% corn oil

    Solubility: ≥ 2.5 mg/mL (0.74 mM); Clear solution

*All of the co-solvents are provided by MCE.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

AviptadilVasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine)SARS-CoVSARS coronavirusRespiratory FailureSarcoidPulmonary FibrosisBronchospasmRespiratory Distress Syndrome ARDSLung InjuryALI SarcoidosisSARS-CoV-2Corona VirusInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Aviptadil acetate
Cat. No.:
HY-P0012A
Quantity:
MCE Japan Authorized Agent: