1. GPCR/G Protein
  2. Neuropeptide Y Receptor

Neuropeptide Y(29-64) 

Cat. No.: HY-P1601
Handling Instructions

Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. Sequence: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y(29-64) Chemical Structure

Neuropeptide Y(29-64) Chemical Structure

CAS No. : 303052-45-1

Size Price Stock
1 mg USD 180 Get quote
5 mg USD 720 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • Purity & Documentation

Description

Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. Sequence: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY.

In Vitro

Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y[1].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2340 mL 1.1702 mL 2.3404 mL
5 mM 0.0468 mL 0.2340 mL 0.4681 mL
10 mM 0.0234 mL 0.1170 mL 0.2340 mL
*Please refer to the solubility information to select the appropriate solvent.
Molecular Weight

4272.70

Formula

C₁₈₉H₂₈₄N₅₄O₅₈S

CAS No.

303052-45-1

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr;不竞价
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropeptide Y(29-64)
Cat. No.:
HY-P1601
Quantity:

Neuropeptide Y(29-64)

Cat. No.: HY-P1601