AKR1B1 Protein, Human (His)

The AKR1B1 protein uses NADPH to reduce various carbonyl compounds to alcohols. AKR1B1 Protein, Human (His) is the recombinant human-derived AKR1B1 protein, expressed by E. coli , with N-His, N-10*His labeled tag. The total length of AKR1B1 Protein, Human (His) is 316 a.a., with molecular weight of ~36 kDa.

AKR1B1, a versatile enzyme, catalyzes the NADPH-dependent reduction of a diverse array of carbonyl-containing compounds to their respective alcohols. It exhibits enzymatic activity towards endogenous metabolites, including aromatic and aliphatic aldehydes, ketones, monosaccharides, bile acids, and xenobiotics substrates. As a key enzyme in the polyol pathway, AKR1B1 plays a critical role in hyperglycemia by catalyzing the reduction of glucose to sorbitol. The enzyme also reduces steroids and their derivatives, prostaglandins, and displays low activity toward retinals. Additionally, AKR1B1 is involved in the detoxification of dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal, and their glutathione-conjugate carbonyls (GS-carbonyls). Notably, it catalyzes the reduction of various phospholipid aldehydes generated from the oxidation of phosphatidylcholine and phosphatidylethanolamides, further emphasizing its broad substrate specificity and its integral role in cellular detoxification processes.

Measured by its ability to catalyzes glucuronic acid decomposition in the presence of NADPH. The specific activity is 132.9 U/mg.

Human

E. coli

N-His;N-10*His

P15121 (M1-F316)

231  [NCBI]

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

Approximately 36 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.