1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. AKR1B1 Protein, Human (His)

The AKR1B1 protein uses NADPH to reduce various carbonyl compounds to alcohols. AKR1B1 Protein, Human (His) is the recombinant human-derived AKR1B1 protein, expressed by E. coli , with N-10*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The AKR1B1 protein uses NADPH to reduce various carbonyl compounds to alcohols. AKR1B1 Protein, Human (His) is the recombinant human-derived AKR1B1 protein, expressed by E. coli , with N-10*His labeled tag.

Background

AKR1B1, a versatile enzyme, catalyzes the NADPH-dependent reduction of a diverse array of carbonyl-containing compounds to their respective alcohols. It exhibits enzymatic activity towards endogenous metabolites, including aromatic and aliphatic aldehydes, ketones, monosaccharides, bile acids, and xenobiotics substrates. As a key enzyme in the polyol pathway, AKR1B1 plays a critical role in hyperglycemia by catalyzing the reduction of glucose to sorbitol. The enzyme also reduces steroids and their derivatives, prostaglandins, and displays low activity toward retinals. Additionally, AKR1B1 is involved in the detoxification of dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal, and their glutathione-conjugate carbonyls (GS-carbonyls). Notably, it catalyzes the reduction of various phospholipid aldehydes generated from the oxidation of phosphatidylcholine and phosphatidylethanolamides, further emphasizing its broad substrate specificity and its integral role in cellular detoxification processes.

Actividad biológica

Measured by its ability to catalyzes glucuronic acid decomposition in the presence of NADPH. The specific activity is 132.9 U/mg.

Assay Procedure

Materials
AKR1B1 Protein, Human (His) (HY-P75521): Dissolve in deionized water to a concentration of 100 μg/mL.
Substrate: Glucuronic acid. Accurately weigh 15.520 mg of powder and dissolve in 1 mL of deionized water to a concentration of 80 mM.
Standard: NADPH. Accurately weigh 3.33 mg of solid powder and dissolve in 1 mL of deionized water to a concentration of 4 mM.

Procedure
1. Dilute NADPH to the following concentrations: 0, 0.015625, 0.03125, 0.0625, 0.125, 0.25 mM. Add 200 μL of each concentration to a 96-well plate in triplicate.
2. Measure the absorbance at 340 nm using a microplate reader. Plot a standard curve with the amount of NADPH as the x-axis and the OD value as the y-axis.
3. Dilute the substrate to a concentration of 8 mM for later use.
4. Dilute Human AKR1B1 to 0.2 μg/mL. Mix 50 μL of the substrate with 50 μL of the protein at each concentration, and pre-add to a 96-well plate in triplicate.
5. Dilute 4 mM NADPH to 0.4 mM. Initiate the reaction by adding 100 μL of 0.4 mM NADPH to each well.
6. Zero the microplate reader using the blank group OD value. Measure the absorbance at 340 nm in kinetic mode for 10 min.
7. Define one enzyme unit as the consumption of 1 μmol of NADPH per minute, denoted as U. Calculate the specific enzyme activity.

     Specific Activity (U/mg) =

ΔnNADPH (μmol)
Reaction time (min) x amount of enzyme (mg)

Per Well:
Human AKR1B1: 0.01 μg
Substrate: 2 mM
NADPH: 0.2 mM

Species

Human

Source

E. coli

Tag

N-10*His

Accession

P15121 (M1-F316)

Gene ID

231  [NCBI]

Molecular Construction
N-term
10*His
AKR1B1 (M1-F316)
Accession # P15121
C-term
Protein Length

Full Length

Synonyms
Aldo-keto reductase family 1 member B1; AKR1B1; ALDR1; ALR2
AA Sequence

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

Peso molecular

Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

AKR1B1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

AKR1B1 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
AKR1B1 Protein, Human (His)
Cat. No.:
HY-P75521
Cantidad:
MCE Japan Authorized Agent: