1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Amphiregulin
  5. Amphiregulin Protein, Human (HEK293)

Amphiregulin Protein, Human (HEK293)

Cat. No.: HY-P7002
COA Handling Instructions

Amphiregulin Protein, Human (HEK293, His) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $80 In-stock
50 μg $190 In-stock
100 μg $290 In-stock
500 μg $1150 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Amphiregulin Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Amphiregulin Protein, Human (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Amphiregulin Protein, Human (HEK293, His) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

Background

Amphiregulin, an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs. Amphiregulin is suggested to act as a protective factor in a liver injury model. In mice model with bleomycin-induced pneumopathy, Recombinant Human Amphiregulin improves the survival rate and suppresses the degrees of inflammation and fibrosis and the number of TUNEL-positive cells in lung tissues. Recombinant Human Amphiregulin treatment enhances the activation of Akt and Erk in lung epithelial cells[1].

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect ≤ 14.39 ng/mL, corresponding to a specific activity ≥6.950×104 U/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 14.39 ng/mL, corresponding to a specific activity is 6.950×104 U/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P15514 (S101-K198)

Gene ID

374  [NCBI]

Molecular Construction
N-term
Amphiregulin (S101-K198)
Accession # P15514
C-term
Synonyms
rHuAmphiregulin; AR; AREG; Colorectum cell-derived growth factor; CRDGF
AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Molecular Weight

Approximately 15-23 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Amphiregulin Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amphiregulin Protein, Human (HEK293)
Cat. No.:
HY-P7002
Quantity:
MCE Japan Authorized Agent: