Amphiregulin Protein, Human (HEK293)

Amphiregulin Protein, Human (HEK293) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

Amphiregulin, an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs. Amphiregulin is suggested to act as a protective factor in a liver injury model. In mice model with bleomycin-induced pneumopathy, Recombinant Human Amphiregulin improves the survival rate and suppresses the degrees of inflammation and fibrosis and the number of TUNEL-positive cells in lung tissues. Recombinant Human Amphiregulin treatment enhances the activation of Akt and Erk in lung epithelial cells^[1].

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect < 15 ng/mL.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 14.39 ng/mL, corresponding to a specific activity is 6.950×10⁴ U/mg.

Human

HEK293

Tag Free

P15514 (S101-K198)

374  [NCBI]

Partial

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Approximately 15-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Fukumoto J, et al. Amphiregulin attenuates bleomycin-induced pneumopathy in mice. Am J Physiol Lung Cell Mol Physiol. 2010 Feb;298(2):L131-8.  [Content Brief]