1. Recombinant Proteins
  2. Amphiregulin Protein, Human (HEK293, His)

Amphiregulin Protein, Human (HEK293, His)

Cat. No.: HY-P7002
Handling Instructions

Amphiregulin Protein, Human (HEK293, His) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $80 In-stock
Estimated Time of Arrival: December 31
50 μg $190 In-stock
Estimated Time of Arrival: December 31
100 μg $290 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuAmphiregulin; AR; AREG; Colorectum cell-derived growth factor; CRDGF
Species

Human

Source

HEK 293

Accession

P15514 (S101-K198)

Gene ID

374

Molecular Weight

15-20 kDa

AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Biological Activity
The ED50 is <0.2 ng/mL as measured by 3T3 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Amphiregulin, an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs. Amphiregulin is suggested to act as a protective factor in a liver injury model. In mice model with bleomycin-induced pneumopathy, Recombinant Human Amphiregulin improves the survival rate and suppresses the degrees of inflammation and fibrosis and the number of TUNEL-positive cells in lung tissues. Recombinant Human Amphiregulin treatment enhances the activation of Akt and Erk in lung epithelial cells[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amphiregulin Protein, Human (HEK293, His)
Cat. No.:
HY-P7002
Quantity:
MCE Japan Authorized Agent: