1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Amphiregulin
  5. Amphiregulin Protein, Human (HEK293)

Amphiregulin Protein, Human (HEK293)

Cat. No.: HY-P7002
COA Handling Instructions

Amphiregulin Protein, Human (HEK293, His) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $80 In-stock
50 μg $190 In-stock
100 μg $290 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Amphiregulin Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Amphiregulin Protein, Human (HEK293, His) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

Background

Amphiregulin, an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs. Amphiregulin is suggested to act as a protective factor in a liver injury model. In mice model with bleomycin-induced pneumopathy, Recombinant Human Amphiregulin improves the survival rate and suppresses the degrees of inflammation and fibrosis and the number of TUNEL-positive cells in lung tissues. Recombinant Human Amphiregulin treatment enhances the activation of Akt and Erk in lung epithelial cells[1].

Biological Activity

The ED50 is <0.2 ng/mL as measured by 3T3 cells.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P15514 (S101-K198)

Gene ID

374  [NCBI]

Synonyms
rHuAmphiregulin; AR; AREG; Colorectum cell-derived growth factor; CRDGF
AA Sequence

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Molecular Weight

15-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Amphiregulin Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amphiregulin Protein, Human (HEK293)
Cat. No.:
HY-P7002
Quantity:
MCE Japan Authorized Agent: