Copy Link Print Information

Animal-Free BMP-12/GDF-7 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

BMP-12/GDF-7 Protein, existing as a homodimer with disulfide linkages, is hypothesized to influence the motor area of the primate neocortex. Its distinct structural characteristics suggest a unique mode of action, possibly contributing to cellular events integral to motor area function. The precise details of BMP-12/GDF-7 Protein's role in this neural context and its implications in motor-related processes await further research. Animal-Free BMP-12/GDF-7 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-12/GDF-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Animal-Free BMP-12/GDF-7 Protein, Human (His)
  • Animal-Free BMP-12/GDF-7 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

BMP-12/GDF-7 Protein, existing as a homodimer with disulfide linkages, is hypothesized to influence the motor area of the primate neocortex. Its distinct structural characteristics suggest a unique mode of action, possibly contributing to cellular events integral to motor area function. The precise details of BMP-12/GDF-7 Protein's role in this neural context and its implications in motor-related processes await further research. Animal-Free BMP-12/GDF-7 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-12/GDF-7 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

BMP-12/GDF-7 Protein is postulated to play an active role, potentially exerting its influence in the motor area of the primate neocortex. Existing as a homodimer with disulfide-linkages, this protein's specific mechanisms and molecular interactions within the motor area remain to be fully elucidated. The distinct structural characteristics of the homodimer suggest a unique mode of action, possibly contributing to cellular events that are integral to the function and regulation of the motor area in the primate neocortex. Further research is warranted to uncover the precise details of BMP-12/GDF-7 Protein's role in this neural context and its potential implications in motor-related processes.

Verified Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 2 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    Q7Z4P5 (T322-R450)

  • Gene ID
    151449  [NCBI]
  • Molecular Construction
    • N-term
    • BMP-12 (T322-R450)
      Accession # Q7Z4P5
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GDF7; Growth/Differentiation Factor 7; Growth Differentiation Factor 7; GDF-7; BMP12

  • AA Sequence

    TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

  • Predicted Molecular Mass

    15 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Animal-Free BMP-12/GDF-7 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for Animal-Free BMP-12/GDF-7 Protein, Human (His)
  • Animal-Free BMP-12/GDF-7 Protein, Human (His) Product Image