Animal-Free BMP-12/GDF-7 Protein, Human (His)

BMP-12/GDF-7 Protein, existing as a homodimer with disulfide linkages, is hypothesized to influence the motor area of the primate neocortex. Its distinct structural characteristics suggest a unique mode of action, possibly contributing to cellular events integral to motor area function. The precise details of BMP-12/GDF-7 Protein's role in this neural context and its implications in motor-related processes await further research. Animal-Free BMP-12/GDF-7 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-12/GDF-7 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free BMP-12/GDF-7 Protein, Human (His) is 129 a.a., with molecular weight of ~14.95 kDa.

BMP-12/GDF-7 Protein is postulated to play an active role, potentially exerting its influence in the motor area of the primate neocortex. Existing as a homodimer with disulfide-linkages, this protein's specific mechanisms and molecular interactions within the motor area remain to be fully elucidated. The distinct structural characteristics of the homodimer suggest a unique mode of action, possibly contributing to cellular events that are integral to the function and regulation of the motor area in the primate neocortex. Further research is warranted to uncover the precise details of BMP-12/GDF-7 Protein's role in this neural context and its potential implications in motor-related processes.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <112 ng/mL

Human

E. coli

C-His

Q7Z4P5 (T322-R450)

151449  [NCBI]

MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Approximately 14.95 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.