Animal-Free IL-20 Protein, Mouse (His)

IL-20 Protein, secreted by monocytes and skin keratinocytes, is a pro-inflammatory cytokine crucial for immune responses, inflammatory regulation, hemopoiesis, and epidermal cell differentiation. It enhances tissue remodeling and wound healing, maintaining epithelial integrity during infection. IL-20 Protein impacts actin-mediated functions in neutrophils, inhibiting phagocytosis, granule exocytosis, and migration. It signals through IL20RA/IL20RB or IL22RA1/IL20RB complexes, activating JAK2, STAT5, AKT, and ERK1/2 phosphorylations. In keratinocytes, it activates STAT3 in a JAK2, ERK1/2, and p38 MAPK-dependent manner, forming a heterotrimeric complex with its receptor IL20RA/IL20RB. Animal-Free IL-20 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-20 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-20 Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.52 kDa.

IL-20 Protein, a pro-inflammatory and angiogenic cytokine, is primarily secreted by monocytes and skin keratinocytes, and it serves crucial roles in immune responses, regulation of inflammatory responses, hemopoiesis, as well as epidermal cell and keratinocyte differentiation. This protein enhances tissue remodeling and wound-healing activities, playing a key role in maintaining the integrity of epithelial layers during infection and inflammatory responses. IL-20 Protein affects various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are exerted through the type I IL-20 receptor complex (IL20RA and IL20RB) or the type II IL-20 receptor complex (IL22RA1 and IL20RB). Furthermore, IL-20 Protein activates a range of signaling processes, including phosphorylations of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. In keratinocytes, it can activate STAT3 phosphorylation and transcriptional activity in a JAK2, ERK1/2, and p38 MAPK-dependent manner. IL-20 Protein forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <2 ng/mL.

Mouse

E. coli

C-His

Q9JKV9 (L25- L176)

58181  [NCBI]

MLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML

Approximately 18.52 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.