Animal-Free IL-20 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

IL-20 protein is secreted by monocytes and skin keratinocytes and is a proinflammatory cytokine critical for immune responses, inflammatory regulation, hematopoiesis, and epidermal cell differentiation. It enhances tissue remodeling and wound healing, maintaining epithelial integrity during infection. Animal-Free IL-20 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-20 protein is secreted by monocytes and skin keratinocytes and is a proinflammatory cytokine critical for immune responses, inflammatory regulation, hematopoiesis, and epidermal cell differentiation. It enhances tissue remodeling and wound healing, maintaining epithelial integrity during infection. Animal-Free IL-20 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-20 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-20 Protein, a pro-inflammatory and angiogenic cytokine, is primarily secreted by monocytes and skin keratinocytes, and it serves crucial roles in immune responses, regulation of inflammatory responses, hemopoiesis, as well as epidermal cell and keratinocyte differentiation. This protein enhances tissue remodeling and wound-healing activities, playing a key role in maintaining the integrity of epithelial layers during infection and inflammatory responses. IL-20 Protein affects various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are exerted through the type I IL-20 receptor complex (IL20RA and IL20RB) or the type II IL-20 receptor complex (IL22RA1 and IL20RB). Furthermore, IL-20 Protein activates a range of signaling processes, including phosphorylations of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. In keratinocytes, it can activate STAT3 phosphorylation and transcriptional activity in a JAK2, ERK1/2, and p38 MAPK-dependent manner. IL-20 Protein forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.

Verified Bioactivity

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <2 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-2 (L25-L176)
      Accession # Q9JKV9
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL20; Cytokine Zcyto10; Interleukin 20; Interleukin-20; ZCYTO10; Interleukin Family Protein; IL-20; Four Alpha Helix Cytokine; IL10D

  • AA Sequence

    LKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML

  • Predicted Molecular Mass

    18.5 kDa

  • Molecular Weight

    Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00