1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 alpha
  6. Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His)

Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His)

Cat. No.: HY-P700126AF
COA Handling Instructions

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is 153 a.a., with molecular weight of ~18.05 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg $72 In-stock
10 μg $200 In-stock
50 μg $560 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is 153 a.a., with molecular weight of ~18.05 kDa.

Background

IL-36 alpha/IL-1F6 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating the NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers and involved in local inflammatory responses, sharing similarities with the IL-1 system through the coreceptor IL1RAP. IL-36 alpha/IL-1F6 appears to play a crucial role in skin inflammatory responses by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, promoting tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, it induces the expression of various chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. Additionally, IL-36 alpha/IL-1F6 up-regulates the expression of IL-1A, IL-1B, and IL-6 in cultured monocytes, promotes cell maturation in myeloid dendritic cells, and facilitates dendritic cell maturation while driving T-cell proliferation in monocyte-derived dendritic cells. Its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-36 alpha/IL-1F6 may contribute to pro-inflammatory effects in the lung.

Biological Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.7 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9UHA7 (K6-F158)

Gene ID

14440

Molecular Construction
N-term
IL-36α (K6-F158)
Accession # Q9UHA7
His
C-term
Synonyms
IL-36 alpha; IL-36α; Interleukin-36 Alpha; FIL1 Epsilon; Interleukin-1 Epsilon; IL-1 Epsilon; Interleukin-1 Family Member 6; IL-1F6; IL36A; FIL1E; IL1E; IL1F6
AA Sequence

MKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Molecular Weight

Approximately 18.05 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His)
Cat. No.:
HY-P700126AF
Quantity:
MCE Japan Authorized Agent: