Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His)

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is 160 a.a., with molecular weight of ~18.82 kDa.

IL-36 alpha protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system present in epithelial barriers and sharing similarities with the IL-1 system, IL-36 alpha seems integral to local inflammatory responses. It plays a crucial role in the skin inflammatory response by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, driving tissue infiltration, cell maturation, and proliferation. IL-36 alpha induces the production of various pro-inflammatory cytokines, including IL-12, IL-1 beta, IL-6, TNF-alpha, and IL-23 in bone marrow-derived dendritic cells (BMDCs), contributing to dendritic cell maturation by stimulating the surface expression of CD80, CD86, and MHC class II. Additionally, IL-36 alpha induces the production of IFN-gamma, IL-4, and IL-17 in cultured CD4(+) T-cells and splenocytes, possibly playing a role in T-cell maturation and proliferation. Its involvement in pro-inflammatory effects extends to the lung, where it induces the expression of CXCL1 and CXCL2 and the expression of TNF-alpha, IL-36c, IL-1A, IL-1B, CXCL1, and CXCL2 in isolated splenic CD11c(+) alveolar macrophages. IL-36 alpha may also be involved in T-cell maturation by stimulating the surface expression of CD40, CD80, and CD86 in splenic CD11c(+) cells. Furthermore, IL-36 alpha induces NF-kappa B activation in macrophages, and its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), facilitating secretion.

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is >1 x 10⁵ IU/mg.

Mouse

E. coli

C-His

Q9JLA2 (M1-H160)

54448  [NCBI]

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Approximately 18.82 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.