1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IP-10/CXCL10
  6. Animal-Free IP-10/CXCL10 Protein, Human (His)

Animal-Free IP-10/CXCL10 Protein, Human (His)

Art. -Nr.: HY-P700041AF
Handling Instructions Technical Support

The IP-10/CRG-2/CXCL10 protein is a pro-inflammatory cytokine involved in a variety of biological processes, including chemotaxis, immune cell activation, growth regulation, apoptosis, and vasostatic regulation. During viral infection, IP-10 crucially stimulates immune cell activation and migration to the site of infection. Animal-Free IP-10/CXCL10 Protein, Human (His) is the recombinant human-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
2 μg Auf Lager
5 μg Auf Lager
10 μg Auf Lager
20 μg Auf Lager
50 μg Auf Lager
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

The IP-10/CRG-2/CXCL10 protein is a pro-inflammatory cytokine involved in a variety of biological processes, including chemotaxis, immune cell activation, growth regulation, apoptosis, and vasostatic regulation. During viral infection, IP-10 crucially stimulates immune cell activation and migration to the site of infection. Animal-Free IP-10/CXCL10 Protein, Human (His) is the recombinant human-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Background

IP-10 (CXCL10), a pro-inflammatory cytokine, is implicated in a diverse array of biological processes, including chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis, and modulation of angiostatic effects. Notably, during viral infections, IP-10 plays a pivotal role by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, the binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling, leading to downstream activation of the phospholipase C-dependent pathway, an increase in intracellular calcium production, and actin reorganization. This cascade results in the recruitment of activated Th1 lymphocytes to sites of inflammation. The CXCL10/CXCR3 axis also holds significance in neurons, responding to brain injury by activating microglia—the resident macrophage population of the central nervous system—and guiding them to the lesion site, a crucial element for neuronal reorganization. IP-10 exists in monomeric, dimeric, and tetrameric forms and interacts with CXCR3, specifically through its N-terminus.

Biologische Aktivität

1. Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is < 0.15 μg/mL.
2. Measure by its ability to chemoattract human THP1 cell using a concentration range of 10-50 ng/mL.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P02778 (V22-P98)

Gene ID
Molecular Construction
N-term
6*His
IP-10/CXCL10 (V22-P98)
Accession # P02778
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IP-10/CXCL10; C-X-C motif chemokine 10; Gamma-IP10; Mob-1
AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Predicted Molecular Mass
9.5 kDa
Molekulargewicht

Approximately 9-11 kDa, based on SDS-PAGE under reducing conditions.

Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose or 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

Animal-Free IP-10/CXCL10 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Animal-Free IP-10/CXCL10 Protein, Human (His)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Animal-Free IP-10/CXCL10 Protein, Human (His)
Art. -Nr.:
HY-P700041AF
Menge:
MCE Japan Authorized Agent: