Animal-Free KGF-2/FGF-10 Protein, Human (His)

KGF-2/FGF-10 Protein orchestrates embryonic development, regulating cell proliferation and differentiation, with indispensable significance in branching morphogenesis. This versatile protein potentially contributes to wound healing. Engaging with FGFR1 and FGFR2, it forms molecular complexes, highlighting its multifaceted functions. Interactions with FGFBP1 emphasize its intricate network in orchestrating cellular responses and developmental events during embryogenesis. Animal-Free KGF-2/FGF-10 Protein, Human (His) is the recombinant human-derived animal-FreeKGF-2/FGF-10 protein, expressed by E. coli, with C-His, C-His labeled tag. The total length of Animal-Free KGF-2/FGF-10 Protein, Human (His) is 169 a.a., with molecular weight of ~20.06 kDa.

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <8 ng/mL. The specific activity of recombinant human FGF-10 is >1.2 x 10⁵ IU/mg.

Human

E. coli

C-His;C-His

O15520 (L40-S208)

2255  [NCBI]

MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Approximately 20.06 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.