Animal-Free KGF-2/FGF-10 Protein, Human (His)

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. Animal-Free KGF-2/FGF-10 Protein, Human (His) is the recombinant human-derived animal-FreeKGF-2/FGF-10 protein, expressed by E. coli , with C-His, C-His labeled tag. This product is for cell culture use only.

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.

1. Measure by its ability to induce NIH/3T3 cells proliferation. The ED₅₀ for this effect is <8 ng/mL. The specific activity of recombinant human FGF-10 is >1.2 x 10⁵ IU/mg.
2. Measure by its ability to induce NIH/3T3 cells proliferation. The ED₅₀ for this effect is 3.76 ng/mL, corresponding to a specific activity is 2.66×10⁵ units/mg.

• 
  Measure by its ability to induce NIH/3T3 cells proliferation. The ED₅₀ for this effect is 3.76 ng/mL, corresponding to a specific activity is 2.66×10⁵ units/mg.

Human

E. coli

C-6*His

O15520 (L40-S208)

2255  [NCBI]

Full Length of Mature Protein

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.

<0.1 EU/μg, determined by LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.