Animal-Free Nodal Protein, Human (His)

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. Animal-Free Nodal Protein, Human (His) is the recombinant human-derived animal-FreeNodal protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Nodal Protein, Human (His) is 110 a.a., with molecular weight of ~13.75 kDa.

Nodal protein plays a pivotal role in embryonic development, serving as an indispensable factor for both mesoderm formation and axial patterning. As a homodimer held together by disulfide linkages, Nodal contributes to the molecular framework that governs essential developmental pathways, ensuring the proper establishment of mesodermal tissues and axial structures during embryogenesis. This protein, free from animal-derived components, underscores its suitability for applications demanding stringent purity and ethical considerations in research and biotechnological endeavors.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <2.2 ng/mL.

Human

E. coli

C-His

Q96S42 (H238-L347)

4838  [NCBI]

MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

Approximately 13.75 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.