1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H2/ICOSLG B7-H2/CD275
  5. B7-H2/ICOSLG Protein, Human (HEK293, Fc)

B7-H2/ICOSLG Protein, Human (HEK293, Fc)

Cat. No.: HY-P7324
COA Handling Instructions

B7-H2/ICOSLG Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal human IgG1 Fc fragment produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $110 In-stock
50 μg $210 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B7-H2/ICOSLG Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal human IgG1 Fc fragment produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Background

As a member of the B7 family, inducible co-stimulator ligand (ICOSLG) expressed on tumor cell has been reported to have an important role in tumor immunity. As the counter ligand of ICOS, a CD28-related molecule, ICOSLG is expressed on professional antigen-presenting cell (APCs; such as dendritic cells (DCs) and B cells) and on some tumor cells (such as glioma cells and gastric carcinoma cells). ICOSLG is the only B7 family member that preferentially co-stimulates type 2T helper cell (Th2) responses, and interestingly, this unique molecule has a critical role in antitumor immunity. ICOSLG expression on solid tumors (implanted-transfected tumors) aids in both NK mediated and CD8+ cytotoxic T cell (CTL) activation and killing. Several studies using ICOSLG-transfected solid tumor cell lines found that ICOSLG induced CD8+ cytotoxic lymphocyte-mediated tumor regression[1].

Biological Activity

5 µg/mL (100 µL/well) of immoblized recombinant human B7-H2/ICOSLG-Fc can bind human Biotin-B7-H2/ICOSLG-Fc with a linear range of 0.76-12.21 μg/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O75144 (D19-S258)

Gene ID
Synonyms
rHuB7-H2/ICOSLG, Fc Chimera; B7 homolog 2; B7RP-1; CD275
AA Sequence

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS

Molecular Weight

70-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, 5% trehalose and mannitol.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H2/ICOSLG Protein, Human (HEK293, Fc)
Cat. No.:
HY-P7324
Quantity:
MCE Japan Authorized Agent: