1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Biliverdin Reductase A/BLVRA Protein, Human (N-His)

Biliverdin Reductase A/BLVRA Protein, Human (N-His)

Cat. No.: HY-P7664A
COA Handling Instructions

Biliverdin Reductase A/BLVRA catalyzes the reduction of biliverdin IX alpha to bilirubin, utilizing either NADH or NADPH as a cofactor. The pH-dependent preference involves NADH at acidic pH (6-6.9) and NADPH at alkaline pH (8.5-8.7), with NADPH being the predominant reactant in biological systems. This enzymatic activity plays a crucial role in heme catabolism, influencing physiological processes and cellular redox balance. Biliverdin Reductase A/BLVRA Protein, Human (N-His) is the recombinant human-derived Biliverdin Reductase A/BLVRA protein, expressed by E. coli , with N-6*His labeled tag. The total length of Biliverdin Reductase A/BLVRA Protein, Human (N-His) is 289 a.a., with molecular weight of ~40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $98 In-stock
10 μg $168 In-stock
50 μg $504 In-stock
100 μg $855 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Biliverdin Reductase A/BLVRA catalyzes the reduction of biliverdin IX alpha to bilirubin, utilizing either NADH or NADPH as a cofactor. The pH-dependent preference involves NADH at acidic pH (6-6.9) and NADPH at alkaline pH (8.5-8.7), with NADPH being the predominant reactant in biological systems. This enzymatic activity plays a crucial role in heme catabolism, influencing physiological processes and cellular redox balance. Biliverdin Reductase A/BLVRA Protein, Human (N-His) is the recombinant human-derived Biliverdin Reductase A/BLVRA protein, expressed by E. coli , with N-6*His labeled tag. The total length of Biliverdin Reductase A/BLVRA Protein, Human (N-His) is 289 a.a., with molecular weight of ~40 kDa.

Background

The Biliverdin Reductase A/BLVRA protein serves as a catalyst in the reduction of the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin, accompanied by the oxidation of a NADH or NADPH cofactor. The choice between NADH and NADPH as a cofactor is pH-dependent, with NADH being utilized in the acidic pH range (6-6.9) and NADPH at the alkaline range (8.5-8.7). In biological systems, however, NADPH is considered the probable and more prevalent reactant. This enzymatic activity highlights the pivotal role of BLVRA in the conversion of biliverdin to bilirubin, a critical step in heme catabolism with implications for various physiological processes and cellular redox balance.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P53004 (E6-S294)

Gene ID

644  [NCBI]

Molecular Construction
N-term
6*His
BLVRA (E6-S294)
Accession # P53004
C-term
Synonyms
BLVRA; Biliverdin reductase A
AA Sequence

ERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCS

Molecular Weight

Approximately 40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For lower concentration,please reconstitute in 50 mM Tris-HCL,300 mM NaCl, pH 7.4 buffer.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Biliverdin Reductase A/BLVRA Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Biliverdin Reductase A/BLVRA Protein, Human (N-His)
Cat. No.:
HY-P7664A
Quantity:
MCE Japan Authorized Agent: