1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Biliverdin Reductase A/BLVRA Protein, Human (N-His)

Biliverdin Reductase A/BLVRA Protein, Human (N-His)

Cat. No.: HY-P7664A
Handling Instructions

Biliverdin Reductase A/BLVRA catalyzes the reduction of biliverdin IX alpha to bilirubin, utilizing either NADH or NADPH as a cofactor. The pH-dependent preference involves NADH at acidic pH (6-6.9) and NADPH at alkaline pH (8.5-8.7), with NADPH being the predominant reactant in biological systems. This enzymatic activity plays a crucial role in heme catabolism, influencing physiological processes and cellular redox balance. Biliverdin Reductase A/BLVRA Protein, Human (N-His) is the recombinant human-derived Biliverdin Reductase A/BLVRA protein, expressed by E. coli , with N-6*His labeled tag. The total length of Biliverdin Reductase A/BLVRA Protein, Human (N-His) is 289 a.a., with molecular weight of ~40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg $98 Ask For Quote & Lead Time
10 μg $168 Ask For Quote & Lead Time
50 μg $504 Ask For Quote & Lead Time
100 μg $855 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Biliverdin Reductase A/BLVRA catalyzes the reduction of biliverdin IX alpha to bilirubin, utilizing either NADH or NADPH as a cofactor. The pH-dependent preference involves NADH at acidic pH (6-6.9) and NADPH at alkaline pH (8.5-8.7), with NADPH being the predominant reactant in biological systems. This enzymatic activity plays a crucial role in heme catabolism, influencing physiological processes and cellular redox balance. Biliverdin Reductase A/BLVRA Protein, Human (N-His) is the recombinant human-derived Biliverdin Reductase A/BLVRA protein, expressed by E. coli , with N-6*His labeled tag. The total length of Biliverdin Reductase A/BLVRA Protein, Human (N-His) is 289 a.a., with molecular weight of ~40 kDa.

Background

The Biliverdin Reductase A/BLVRA protein serves as a catalyst in the reduction of the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin, accompanied by the oxidation of a NADH or NADPH cofactor. The choice between NADH and NADPH as a cofactor is pH-dependent, with NADH being utilized in the acidic pH range (6-6.9) and NADPH at the alkaline range (8.5-8.7). In biological systems, however, NADPH is considered the probable and more prevalent reactant. This enzymatic activity highlights the pivotal role of BLVRA in the conversion of biliverdin to bilirubin, a critical step in heme catabolism with implications for various physiological processes and cellular redox balance.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P53004 (E6-S294)

Gene ID

644  [NCBI]

Molecular Construction
N-term
6*His
BLVRA (E6-S294)
Accession # P53004
C-term
Synonyms
BLVRA; Biliverdin reductase A
AA Sequence

ERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCS

Molecular Weight

Approximately 40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Biliverdin Reductase A/BLVRA Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Biliverdin Reductase A/BLVRA Protein, Human (N-His)
Cat. No.:
HY-P7664A
Quantity:
MCE Japan Authorized Agent: