1. Recombinant Proteins
  2. Others
  3. CABP5 Protein, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CABP5 Protein, Human (His) is 173 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CABP5 Protein, Human (His) is 173 a.a., with molecular weight of ~19 kDa.

Background

CABP5 protein functions as an inhibitor, modulating the calcium-dependent inactivation of L-type calcium channels and shifting the voltage dependence of activation to more depolarized membrane potentials. It is implicated in the transmission of light signals and may positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner. Additionally, CABP5 may contribute to the extension and network organization of neurites. The protein interacts with CACNA1C in a calcium-dependent manner and forms associations with STXBP1 and MYO6.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NP86 (M1-R173)

Gene ID

56344  [NCBI]

Molecular Construction
N-term
6*His
CABP5 (M1-R173)
Accession # Q9NP86
C-term
Synonyms
Calcium-binding protein 5; CABP5; CABP3
AA Sequence

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CABP5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CABP5 Protein, Human (His)
Cat. No.:
HY-P76754
Quantity:
MCE Japan Authorized Agent: