CABP5 Protein, Human (His)
Based on 1 Customer Validation
The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.
CABP5 protein functions as an inhibitor, modulating the calcium-dependent inactivation of L-type calcium channels and shifting the voltage dependence of activation to more depolarized membrane potentials. It is implicated in the transmission of light signals and may positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner. Additionally, CABP5 may contribute to the extension and network organization of neurites. The protein interacts with CACNA1C in a calcium-dependent manner and forms associations with STXBP1 and MYO6.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NP86 (M1-R173)
-
Gene ID56344 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
CABP5 (M1-R173)
Accession # Q9NP86 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CABP5; Calcium-Binding Protein 5; Prev. CABP3; Calcium-Binding Protein 3; CaBP3; CaBP5; Calcium Binding Protein 5; Calcium Binding Protein 3
-
AA Sequence
MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
