CABP5 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CABP5 protein functions as an inhibitor, modulating the calcium-dependent inactivation of L-type calcium channels and shifting the voltage dependence of activation to more depolarized membrane potentials. It is implicated in the transmission of light signals and may positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner. Additionally, CABP5 may contribute to the extension and network organization of neurites. The protein interacts with CACNA1C in a calcium-dependent manner and forms associations with STXBP1 and MYO6.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CABP5 (M1-R173)
      Accession # Q9NP86
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CABP5; Calcium-Binding Protein 5; Prev. CABP3; Calcium-Binding Protein 3; CaBP3; CaBP5; Calcium Binding Protein 5; Calcium Binding Protein 3

  • AA Sequence

    MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00