CABP5 Protein, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CABP5 Protein, Human (His) is 173 a.a., with molecular weight of ~19 kDa.

CABP5 protein functions as an inhibitor, modulating the calcium-dependent inactivation of L-type calcium channels and shifting the voltage dependence of activation to more depolarized membrane potentials. It is implicated in the transmission of light signals and may positively regulate neurotransmitter vesicle endocytosis and exocytosis in a salt-dependent manner. Additionally, CABP5 may contribute to the extension and network organization of neurites. The protein interacts with CACNA1C in a calcium-dependent manner and forms associations with STXBP1 and MYO6.

Data is not available.

Human

E. coli

N-6*His

Q9NP86 (M1-R173)

56344  [NCBI]

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Approximately 19 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.