CD164 Protein, Rat (HEK293, Fc)

CD164 Protein, a sialomucin, crucially influences hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration and promoting the fusion of myoblasts into myotubes through interactions with CXCR4. This highlights CD164's significant role in various cellular activities related to muscle development and function. CD164 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD164 Protein, Rat (HEK293, Fc) is 160 a.a., with molecular weight of 90-120 kDa, respectively.

CD164 protein is a sialomucin that potentially plays a crucial role in hematopoiesis and may also be involved in cell adhesion. It exerts its influence on myogenesis by enhancing CXCR4-dependent cell motility and positively regulates the migration of myoblasts. Additionally, CD164 protein promotes the fusion of myoblasts into myotubes, a process that is analogous to other similar proteins. Notably, it interacts with CXCR4, further emphasizing its significance in various cellular activities related to muscle development and function.

When Recombinant Rat CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED₅₀ for this effect is 15.05 ng/mL.

Rat

HEK293

C-hFc

Q9QX82 (Q24-D160)

83689  [NCBI]

QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTNNITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD

Approximately 90-120 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.