Copy Link Print Information

CD164 Protein, Rat (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD164 Protein, a sialomucin, crucially influences hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration and promoting the fusion of myoblasts into myotubes through interactions with CXCR4. This highlights CD164's significant role in various cellular activities related to muscle development and function. CD164 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD164 Protein, Rat (HEK293, Fc)
  • Experimental Validation Results for CD164 Protein, Rat (HEK293, Fc)
  • CD164 Protein, Rat (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD164 Protein, a sialomucin, crucially influences hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration and promoting the fusion of myoblasts into myotubes through interactions with CXCR4. This highlights CD164's significant role in various cellular activities related to muscle development and function. CD164 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD164 protein is a sialomucin that potentially plays a crucial role in hematopoiesis and may also be involved in cell adhesion. It exerts its influence on myogenesis by enhancing CXCR4-dependent cell motility and positively regulates the migration of myoblasts. Additionally, CD164 protein promotes the fusion of myoblasts into myotubes, a process that is analogous to other similar proteins. Notably, it interacts with CXCR4, further emphasizing its significance in various cellular activities related to muscle development and function.

Verified Bioactivity

When Recombinant Rat CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 15.05 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    When Recombinant Rat CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 15.05 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q9QX82 (Q24-D160)

  • Gene ID
    83689  [NCBI]
  • Molecular Construction
    • N-term
    • CD164 (Q24-D160)
      Accession # Q9QX82
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD164; Endolyn; CD164 Molecule; DFNA66; MGC-24v; CD164 Antigen, Sialomucin; MUC-24; Deafness, Autosomal Dominant 66; MGC-24; CD164 Molecule, Sialomucin; Multi-Glycosylated Core Protein 24; CD164 Variant C; Sialomucin Core Protein 24; CD164 Antigen

  • AA Sequence

    QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTNNITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD

  • Molecular Weight

    Approximately 90 kDa & 35 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     When Recombinant Rat CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 15.05 ng/mL.

  • CD164 Protein, Rat (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for CD164 Protein, Rat (HEK293, Fc)
  • Experimental Validation Results for CD164 Protein, Rat (HEK293, Fc)
  • CD164 Protein, Rat (HEK293, Fc) Product Image