CD164 Protein, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34(+) cell adhesion while negatively regulating CD34(+)CD38(lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

CD164 is a sialomucin that potentially holds a pivotal role in hematopoiesis, facilitating the adhesion of CD34(+) cells to the stroma while negatively regulating the proliferation of CD34(+)CD38(lo/-) cells. This protein is implicated in the modulation of umbilical cord blood CD133+ cell migration through the CXCL12/CXCR4 axis. Additionally, CD164 is associated with prostate cancer metastasis and the infiltration of cancer cells into the bone marrow. It exerts a positive influence on myogenesis by enhancing CXCR4-dependent cell motility, promoting myoblast migration, and facilitating myoblast fusion into myotubes. The protein exists as a homodimer (isoform 4) and interacts with CXCR4 in these cellular processes.

Measured by its ability to chemoattract of PC-3 cells. The ED₅₀ for this effect is 1-10 μg/mL.

• 
  Measured by its ability to chemoattract of PC-3 cells. The ED₅₀ for this effect is 6.165 μg/mL, corresponding to a specific activity is 162.2 U/mg.

Human

HEK293

C-6*His

Q04900-1 (D24-D162)

8763  [NCBI]

Extracellular Domain

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Approximately 35-95 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.