1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. MUC-24/CD164
  5. CD164 Protein, Human (HEK293, His)

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34(+) cell adhesion while negatively regulating CD34(+)CD38(lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34(+) cell adhesion while negatively regulating CD34(+)CD38(lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD164 is a sialomucin that potentially holds a pivotal role in hematopoiesis, facilitating the adhesion of CD34(+) cells to the stroma while negatively regulating the proliferation of CD34(+)CD38(lo/-) cells. This protein is implicated in the modulation of umbilical cord blood CD133+ cell migration through the CXCL12/CXCR4 axis. Additionally, CD164 is associated with prostate cancer metastasis and the infiltration of cancer cells into the bone marrow. It exerts a positive influence on myogenesis by enhancing CXCR4-dependent cell motility, promoting myoblast migration, and facilitating myoblast fusion into myotubes. The protein exists as a homodimer (isoform 4) and interacts with CXCR4 in these cellular processes.

Biological Activity

Measured by its ability to chemoattract of PC-3 cells. The ED50 for this effect is 1-10 μg/mL.

  • Measured by its ability to chemoattract of PC-3 cells. The ED50 for this effect is 6.165 μg/mL, corresponding to a specific activity is 162.2 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q04900-1 (D24-D162)

Gene ID
Molecular Construction
N-term
CD164 (D24-D162)
Accession # Q04900-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Sialomucin core protein 24; MUC-24; Endolyn; MGC-24; CD164
AA Sequence

DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Molecular Weight

Approximately 40-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD164 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD164 Protein, Human (HEK293, His)
Cat. No.:
HY-P75617
Quantity:
MCE Japan Authorized Agent: