CLEC-1/CLEC1A Protein, Human (HEK293, Fc)

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CLEC-1/CLEC1A Protein, Human (HEK293, Fc) is 204 a.a., with molecular weight of ~56.48 kDa.

The C-type lectin-like domain-containing protein 1 (CLEC1A) is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily, known for its diverse functions, including cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. This protein is implicated in the potential regulation of dendritic cell function. Situated on chromosome 12p13 in the natural killer gene complex region, CLEC1A is closely linked to other members of the CTL/CTLD superfamily. Alternative splicing gives rise to multiple transcript variants, contributing to the functional diversity of this gene. With biased expression observed in placenta (RPKM 18.1), lung (RPKM 3.8), and 10 other tissues, CLEC1A underscores its potential role in various physiological contexts.

Data is not available.

Human

HEK293

N-hFc

NP_057595.2 (Q77-D280)

51267  [NCBI]

QLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

Approximately 56.48 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.