Copy Link Print Information

CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The CLEC1B/CLEC-2 protein serves as a platelet receptor for PDPN. When activated, it signals through SRC and SYK kinases, activating PLCG2. CLEC1B forms homodimers and interacts with RACK1, promoting its ubiquitination and degradation. It also interacts with SYK and PDPN, independently of glycosylation, activating CLEC1B/CLEC-2. CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC1B/CLEC-2 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)
  • CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CLEC1B/CLEC-2 protein serves as a platelet receptor for PDPN. When activated, it signals through SRC and SYK kinases, activating PLCG2. CLEC1B forms homodimers and interacts with RACK1, promoting its ubiquitination and degradation. It also interacts with SYK and PDPN, independently of glycosylation, activating CLEC1B/CLEC-2. CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC1B/CLEC-2 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CLEC1B/CLEC-2 Protein is a C-type lectin-like receptor that serves as a platelet receptor for PDPN, a marker of lymphatic endothelial cells. Upon ligand activation, CLEC1B/CLEC-2 signals through the sequential activation of SRC and SYK tyrosine kinases, ultimately leading to the activation of PLCG2. It forms homodimers and interacts with RACK1 through its cytoplasmic domain, promoting CLEC1B ubiquitination and subsequent degradation via the proteasome pathway. Additionally, CLEC1B/CLEC-2 interacts with SYK in a dimeric form, facilitated by the SH2 domains of SYK. Furthermore, it interacts with PDPN, and this interaction is independent of CLEC1B glycosylation, resulting in the activation of CLEC1B/CLEC-2.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse Podoplanin is coated at 1.0 µg/mL (100 μL/well), Recombinant Mouse CLEC-2 binds with ED50 of 0.2387 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Mouse Podoplanin is coated at 1.0 µg/mL (100 μL/well), Recombinant Mouse CLEC-2 binds with ED50 of 0.2387 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession

    Q9JL99-1 (M53-L229)

  • Gene ID
    56760  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • CLEC1B (M53-L229)
      Accession # Q9JL99
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC1B; C-Type Lectin Domain Family 1, Member B; C-Type Lectin Domain Family 1 Member B; 1810061I13Rik; CLEC2; PRO1384; CLEC-2; QDED721; C-Type Lectin-Like Receptor 2

  • AA Sequence

    MSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL

  • Molecular Weight

    Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Mouse Podoplanin is coated at 1.0 µg/mL (100 μL/well), Recombinant Mouse CLEC-2 binds with ED50 of 0.2387 μg/mL.

  • CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)
  • CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) Product Image