CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)

The CLEC1B/CLEC-2 protein serves as a platelet receptor for PDPN. When activated, it signals through SRC and SYK kinases, activating PLCG2. CLEC1B forms homodimers and interacts with RACK1, promoting its ubiquitination and degradation. It also interacts with SYK and PDPN, independently of glycosylation, activating CLEC1B/CLEC-2. CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC1B/CLEC-2 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is 177 a.a., with molecular weight of 50-65 kDa.

CLEC1B/CLEC-2 Protein is a C-type lectin-like receptor that serves as a platelet receptor for PDPN, a marker of lymphatic endothelial cells. Upon ligand activation, CLEC1B/CLEC-2 signals through the sequential activation of SRC and SYK tyrosine kinases, ultimately leading to the activation of PLCG2. It forms homodimers and interacts with RACK1 through its cytoplasmic domain, promoting CLEC1B ubiquitination and subsequent degradation via the proteasome pathway. Additionally, CLEC1B/CLEC-2 interacts with SYK in a dimeric form, facilitated by the SH2 domains of SYK. Furthermore, it interacts with PDPN, and this interaction is independent of CLEC1B glycosylation, resulting in the activation of CLEC1B/CLEC-2.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse Podoplanin is coated at 1.0 µg/mL (100 μL/well), Recombinant Mouse CLEC-2 binds with ED₅₀ of 0.2387 μg/mL.

Mouse

HEK293

N-hFc

Q9JL99-1 (M53-L229)

56760  [NCBI]

MSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL

Approximately 50-65 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.