1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B1
  6. Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-B1/EFNB1 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding to Eph receptors on adjacent cells. With high affinity for the receptor tyrosine kinase EPHB1/ELK, EFNB1 can also bind EPHB2 and EPHB3. In vitro, EFNB1 binds to commissural axons/growth cones, inducing their collapse and potentially playing a role in constraining the orientation of longitudinally projecting axons. The protein's interactions extend to binding with GRIP1 and GRIP2 via its PDZ-binding motif, and it interacts with TLE1. Moreover, EFNB1's intracellular domain peptide interacts with ZHX2, enhancing ZHX2's transcriptional repression activity. These multifaceted interactions underscore EFNB1's role in orchestrating intricate signaling events, contributing to various developmental processes and cellular functions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED50 for this effect is 0.2752 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED50 for this effect is 0.2752 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

P52796 (A25-T229)

Gene ID
Molecular Construction
N-term
EFNB1 (A25-T229)
Accession # P52796
His
C-term
Protein Length

Partial

Synonyms
Ephrin-B1; EFL-3; ELK-L; LERK-2; Ephrin-B1 CTF; EFNB1; EFL3; EPLG2; LERK2
AA Sequence

ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDT

분자량

Approximately 29-40 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73030
수량:
MCE Japan Authorized Agent: