Copy Link Print Information

Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)
  • Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-B1/EFNB1 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding to Eph receptors on adjacent cells. With high affinity for the receptor tyrosine kinase EPHB1/ELK, EFNB1 can also bind EPHB2 and EPHB3. In vitro, EFNB1 binds to commissural axons/growth cones, inducing their collapse and potentially playing a role in constraining the orientation of longitudinally projecting axons. The protein's interactions extend to binding with GRIP1 and GRIP2 via its PDZ-binding motif, and it interacts with TLE1. Moreover, EFNB1's intracellular domain peptide interacts with ZHX2, enhancing ZHX2's transcriptional repression activity. These multifaceted interactions underscore EFNB1's role in orchestrating intricate signaling events, contributing to various developmental processes and cellular functions.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED50 for this effect is 0.2752 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED50 for this effect is 0.2752 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    P52796 (A25-T229)

  • Gene ID
    25186  [NCBI]
  • Molecular Construction
    • N-term
    • EFNB1 (A25-T229)
      Accession # P52796
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    EFNB1; ELK Ligand; Prev. EPLG2; Craniofrontonasal Syndrome (Craniofrontonasal Dysplasia); Prev. CFNS; LERK-2; LERK2; ELK-L; EPH-Related Receptor Tyrosine Kinase Ligand 2; EFL-3; Ephrin-B1; CFND; Elk-L; EFB1; Ephrin B1; EFL3

  • AA Sequence

    ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDT

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphB3 (HY-P75749) at 2 µg/mL (100 µL/well) can bind Recombinant Rat Ephrin-B1. The ED50 for this effect is 0.2752 ng/mL.

  • Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for Ephrin-B1/EFNB1 Protein, Rat (HEK293, His)
  • Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) Product Image