Gastrotropin/FABP6 Protein, Human (His)

Gastrotropin/FABP6 is a fatty acid binding protein, or ileal bile acid binding protein (IBABP). FABP6 is a therapeutic target related to immune infiltration, and FABP6 inhibition inhibits cancer cell proliferation and migration. Gastrotropin/FABP6 Protein, Human (His) is the recombinant human-derived Gastrotropin/FABP6 protein, expressed by E. coli , with N-6*His labeled tag.

Gastrotropin/FABP6 is a fatty acid-binding protein also known as ileal bile acid-binding protein (IBABP). FABP6 directly controls the ileal bile acid transport system and is a potential immunotherapy target that is inversely associated with immune infiltration. FABP6 gene is differentially expressed between "hot" and "cold" tumors. Knocking down FABP6 can increase major histocompatibility complex (MHC) class 1 expression and promote the secretion of immune-related chemokines, enhancing the immunogenicity of tumor cells. sex. FABP6 inhibition promotes recruitment of CD8+ T cells, leading to downregulation of autophagy markers and activation of AKT-mTOR signaling. FABP6 inhibition also reduced peroxisome proliferator-activated receptor (PPAR) gamma and retinoid X receptor alpha levels and increased p-p65 expression. Inhibition of FABP6 expression in BC reduces the expression of p53, p21, CDK2, and CDK4, increases cell cycle arrest in the G2/M phase, and therefore may inhibit autophagic flux, proliferation, and migration. Knockdown of FABP6 also inhibits bladder cancer (BC) cell motility by reducing focal adhesion complexes, or inhibits lung adenocarcinoma proliferation and migration.

Human

E. coli

N-6*His

AAH22489.1 (M1-A128)

2172  [NCBI]

Full Length

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Approximately 15 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 mM DTT, 50% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.