1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Growth Differentiation Factor GDNF family
  5. Growth Differentiation Factor 15 (GDF-15)
  6. GDF-15 Protein, Rat (His)

GDF-15 Protein, Rat (His)

Cat. No.: HY-P700727
SDS COA Handling Instructions

GDF-15 Protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Binding to its receptor, GFRAL, activates GFRAL-expressing neurons in the brainstem, triggering a 'stress response circuit.' This involves neurons in the parabrachial nucleus and central amygdala, shaping feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes. Existing as a disulfide-linked homodimer, it acts as a ligand for GFRAL, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag. The total length of GDF-15 Protein, Rat (His) is 115 a.a., with molecular weight of 15-17 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $166 In-stock
50 μg $366 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GDF-15 Protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Binding to its receptor, GFRAL, activates GFRAL-expressing neurons in the brainstem, triggering a 'stress response circuit.' This involves neurons in the parabrachial nucleus and central amygdala, shaping feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes. Existing as a disulfide-linked homodimer, it acts as a ligand for GFRAL, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag. The total length of GDF-15 Protein, Rat (His) is 115 a.a., with molecular weight of 15-17 kDa.

Background

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds to its receptor, GFRAL, leading to the activation of GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons in the parabrachial nucleus and central amygdala, forming part of the 'emergency circuit' involved in shaping feeding responses during stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes. It exists as a homodimer that is disulfide-linked and interacts with GFRAL as its ligand, mediating GDF15 internalization and cellular signaling through interaction with RET.

Biological Activity

Immobilized Rat GDF15, His Tag at 5 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Mouse GFRAL, His Tag with the EC50 of <6.2 μg/mL determined by ELISA.

Species

Rat

Source

E. coli

Tag

N-His

Accession

Q9Z0J6 (S189-A303)

Gene ID
Molecular Construction
N-term
His
GDF-15 (S189-A303)
Accession # Q9Z0J6
C-term
Synonyms
GDF-15; MIC-1; NAG-1; PDF; PLAB; PTGFB; GDF15; MIC1; RG-1; Placental TGF-beta; PTGF-beta; PTGFBPTGF-beta; Placental TGF-β; PTGF-β; PTGFBPTGF-β
AA Sequence

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Weight

15-17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50mM HAc, pH 2.9. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 50mM HAc, pH 2.9.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-15 Protein, Rat (His)
Cat. No.:
HY-P700727
Quantity:
MCE Japan Authorized Agent: