Copy Link Print Information

GDF-15 Protein, Rat (His)

Customer Review

Based on 1 Customer Validation

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GDF-15 Protein, Rat (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Background

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds to its receptor, GFRAL, leading to the activation of GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons in the parabrachial nucleus and central amygdala, forming part of the 'emergency circuit' involved in shaping feeding responses during stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes. It exists as a homodimer that is disulfide-linked and interacts with GFRAL as its ligand, mediating GDF15 internalization and cellular signaling through interaction with RET.

Verified Bioactivity

1. Immobilized Rat GDF15, His Tag at 5 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Mouse GFRAL, His Tag with the EC50 of <6.2 μg/mL determined by ELISA.
2. Immobilized Rat GDF-15, His Tag at 5μg/mL (100μL/well) on the plate. Dose response curve for Human GFRAL, hFc Tag with the EC50 of ≤10.9ng/mL determined by ELISA.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-8*His
  • Accession

    Q9Z0J6 (S189-A303)

  • Gene ID
    29455  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His
    • GDF-15 (S189-A303)
      Accession # Q9Z0J6
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GDF15; Placental Bone Morphogenetic Protein; Growth Differentiation Factor 15; Macrophage Inhibitory Cytokine 1; MIC-1; NSAID-Activated Gene 1 Protein; NAG-1; NSAID-Regulated Gene 1 Protein; PTGFB; Placental TGF-Beta; PLAB; GDF-15; MIC1; NRG-1; PDF; NSAID

  • AA Sequence

    SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 15-17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HAc, pH 2.9, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 50mM HAc, pH 2.9.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GDF-15 Protein, Rat (His) Product Image
    1/16
  • GDF-15 Protein, Rat (His) Product Image