GDF-15 Protein, Rat (His)

GDF-15 Protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Binding to its receptor, GFRAL, activates GFRAL-expressing neurons in the brainstem, triggering a 'stress response circuit.' This involves neurons in the parabrachial nucleus and central amygdala, shaping feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes. Existing as a disulfide-linked homodimer, it acts as a ligand for GFRAL, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag. The total length of GDF-15 Protein, Rat (His) is 115 a.a., with molecular weight of 15-17 kDa.

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds to its receptor, GFRAL, leading to the activation of GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons in the parabrachial nucleus and central amygdala, forming part of the 'emergency circuit' involved in shaping feeding responses during stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes. It exists as a homodimer that is disulfide-linked and interacts with GFRAL as its ligand, mediating GDF15 internalization and cellular signaling through interaction with RET.

Immobilized Rat GDF15, His Tag at 5 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Mouse GFRAL, His Tag with the EC₅₀ of <6.2 μg/mL determined by ELISA.

Rat

E. coli

N-His

Q9Z0J6 (S189-A303)

29455  [NCBI]

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

15-17 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50mM HAc, pH 2.9. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 50mM HAc, pH 2.9.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.