1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. GZMA/Granzyme A Protein, Human (HEK293, His)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Human (HEK293, His) is the recombinant human-derived GZMA/Granzyme A protein, expressed by HEK293 , with C-His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
> 100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE GZMA/Granzyme A Protein, Human (HEK293, His)

  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

  • Verweise

Beschreibung

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Human (HEK293, His) is the recombinant human-derived GZMA/Granzyme A protein, expressed by HEK293 , with C-His labeled tag.

Background

Granzyme A (GZMA) is a highly abundant protease found in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a crucial role in immune defense mechanisms. When delivered into the target cell through the immunological synapse, GZMA activates caspase-independent pyroptosis. It exhibits a substrate specificity for cleavage after lysine or arginine residues. Notably, GZMA cleaves APEX1 after 'Lys-31,' disrupting its oxidative repair activity. Additionally, it targets the nucleosome assembly protein SET, cleaving it after 'Lys-189.' This cleavage event disrupts SET's nucleosome assembly activity and facilitates the translocation of the SET complex into the nucleus, where it is involved in nicking and degrading DNA. The multifunctional activities of GZMA underscore its significance in orchestrating diverse cellular processes during immune responses.

Biologische Aktivität

Measured by its ability to cleave a colorimetric peptide substrate, N-carbobenzyloxy-Gly-Arg-ThioBenzyl ester (Z-GR-SBzl), in the presence of 5,5'-Dithio-bis (2-nitrobenzoic acid) (DTNB). The specific activity is >5000 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by Lysyl endopeptidase for an activated form.)

Species

Human

Source

HEK293

Tag

C-His

Accession

P12544-1/NP_006135.1 (E27-V262)

Gene ID
Molecular Construction
N-term
GZMA (E27-V262)
Accession # P12544-1/NP_006135.1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein (with Propeptide)

Synonyms
CTL tryptase; Cytotoxic T-lymphocyte proteinase 1; Fragmentin-1; Hanukkah factor; HF; CTLA3; HFSP
AA Sequence

EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Molekulargewicht

Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Reinheit
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation
Verweise

GZMA/Granzyme A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

GZMA/Granzyme A Protein, Human (HEK293, His)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
GZMA/Granzyme A Protein, Human (HEK293, His)
Art. -Nr.:
HY-P76377
Menge:
MCE Japan Authorized Agent: