HSF1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

HSF1 is a stress-inducible transcription factor that coordinates the heat shock response by binding to the heat shock element (HSE) and activating heat shock genes. In unstressed cells, it remains inactive in multichaperone complexes. HSF1 Protein, Human (His) is the recombinant human-derived HSF1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

HSF1 is a stress-inducible transcription factor that coordinates the heat shock response by binding to the heat shock element (HSE) and activating heat shock genes. In unstressed cells, it remains inactive in multichaperone complexes. HSF1 Protein, Human (His) is the recombinant human-derived HSF1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

HSF1, a stress-responsive and DNA-binding transcription factor, is a central orchestrator of the heat shock response (HSR), leading to the transcriptional activation of a multitude of heat shock proteins (HSPs) crucial for cellular protection against damage. In unstressed conditions, HSF1 resides in a HSP90-containing multichaperone complex, maintaining an inactivated monomeric state. Upon exposure to stress, particularly heat, HSF1 undergoes homotrimerization and activates the transcription of HSP genes by binding to heat shock elements (HSEs) in their promoters. This transition is reversible, and during the recovery phase of the HSR, HSF1 returns to its unactivated form. Beyond transcriptional activation, HSF1 participates in various cellular processes, including chromatin-associated complex formation with TTC5/STRAP and p300/EP300, repression of Ras-induced c-fos gene transcription, regulation of pre-mRNA processing, nuclear export of stress-induced mRNA, and modulation of mitotic progression. Additionally, in the context of microbial infection, HSF1 plays a role in the reactivation of latent human immunodeficiency virus (HIV-1) transcription by binding to the HIV-1 long terminal repeat promoter.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • HSF1 (D2-S529)
      Accession # Q00613-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HSF1; Heat Shock Factor Protein 1; Heat Shock Transcription Factor 1; HSTF 1; HSTF1; HSF 1

  • AA Sequence

    DLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

  • Molecular Weight

    Approximately 67 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00