1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Human

IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
250 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

76 Publications Citing Use of MCE IFN-gamma Protein, Human

WB
Cell Imaging/Staining
Flow Cytometry

    IFN-gamma Protein, Human purchased from MCE. Usage Cited in: Cancer Res. 2025 Nov 11.  [Abstract]

    Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 under different TSPAN13 expression levels, with or without IFNγ (30 ng/mL, 24 h) stimulation.

    IFN-gamma Protein, Human purchased from MCE. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766.  [Abstract]

    Protein expression levels of TAP1, PD-L1 and β2M after nintedanib combined with IFN-γ (10 ng/mL, 24 h) treated.

    IFN-gamma Protein, Human purchased from MCE. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766.  [Abstract]

    The regulation of STM2457 on the total expression of PD-L1 protein was detected using Western blot in A549 and H1975 cells treated with STM2457 (0, 0.05, 0.5, 5, and 50 mM) with interferon-gamma (IFN-g) induction (10 ng/mL) for 24 h.

    IFN-gamma Protein, Human purchased from MCE. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945.  [Abstract]

    IFI16 expression in A549 cells treated with IFN-γ (50, 500, 1000 ng/mL) for 18 h was determined.

    IFN-gamma Protein, Human purchased from MCE. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945.  [Abstract]

    Intracellular localization of IFI16 in A549 cells treated with poly(I:C) or IFN-γ (500 ng/mL) for 12 h was determined.
    • Biological Activity

    • Technical Parameters

    • Properties

    • 제품 설명

    • References

    제품 설명

    IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.

    Background

    Human Interferon-gamma (hIFNγ) is naturally produced by CD4+ T helper cell type 1 (Th1) lymphocytes, CD8+ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins[2].

    In Vitro

    IFN-gamma Protein (human, 0-1000 ng/mL, 12-18 h) induces IFN-γ-inducible protein-16 (IFI16) accumulation in A549 nucleus and cytoplasm[3].
    IFN-gamma Protein (human, 100 ng/mL, 24 h) promotes the PD-L1 expression, activates PI3K/Akt and ERK1/2 signaling pathways, increases the CD44+/CD24- cell ratio, and enhances cell sphere formation ability. IFN-gamma Protein promotes the stemness of breast cancer cell MCF-7[4].

    Biological Activity

    The ED50 is <1 ng/mL as measured by its ability to inhibit the proliferation of HT-29 cells., corresponding to a specific activity of >1 × 106 units/mg.

    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P01579 (Q24-Q166)

    Gene ID
    Molecular Construction
    N-term
    IFN-gamma (Q24-Q166)
    Accession # P01579
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuIFN-γ; IFNG; IFN-gamma; Interferon gamma
    AA Sequence

    QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

    Predicted Molecular Mass
    16.7 kDa
    분자량

    Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, 5 % trehalose, 5% mannitol, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, 5% mannitol, pH 7.4.
    4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    선적

    Room temperature in continental US; may vary elsewhere.

    각종 서류
    References

    IFN-gamma Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    최근 본 상품:

    온라인 문의

    Your information is safe with us. * Required Fields.

    IFN-gamma Protein, Human

     

    Requested Quantity *

    고객명 *

     

    호칭

    메일주소 *

     

    전화번호 *

    Department

     

    회사명 *

    City

    Country or Region *

         

    비고

    대량구매 문의

    Inquiry Information

    상품명:
    IFN-gamma Protein, Human
    Cat. No.:
    HY-P7025
    수량:
    MCE Japan Authorized Agent: