1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17F
  6. IL-17F Protein, Mouse (133a.a, HEK293, His)

IL-17F Protein, Mouse (133a.a, HEK293, His)

Cat. No.: HY-P72584
COA Handling Instructions

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer. IL-17F Protein, Mouse (133a.a, HEK293, His) is a recombinant mouse IL-17F protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 133 amino acids (R29-A161).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $180 In-stock
50 μg $504 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][2]. IL-17F Protein, Mouse (133a.a, HEK293, His) is a recombinant mouse IL-17F protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 133 amino acids (R29-A161).

Background

Interleukin-17F (IL-17F) belongs to the IL-17 cytokine family. IL-17F is expressed in activated CD4 T cells, activated monocytes, basophils and mast cells. IL-17F can be produced by differentiated TH17 cells, lamina propria T cells, memory CD4+ T cells, γδ T cells and NKT cells[1].
The mouse IL-17F shares 55.90% amino acid sequence identity with human and 86.34% identity with rat.
IL-17F is an inflammatory cytokine that induces many proinflammatory cytokines and chemokines, including TGF-β, IL-2, ICAM1, GM-CSF, CCL2, CCL7, TSLP, MMP13, IL-6 and CXCL1. IL-17F also induces antimicrobial peptides including hBD-2, S100A7, S100A8 and S100A9 with IL-22 and can synergize with IL-23 in human eosinophils to promote the production of IL-1β and IL-6. IL-17F is a homodimeric cytokine. IL-17F shares the most similarities with IL-17A (50% homology) and can be produced as an IL-17AF heterodimer. IL-17A, IL-17F and IL-17A/F use the same receptor complex: IL-17RA and IL-17RC heterodimer. They trigger qualitatively similar signaling pathways, and IL-17F exhibits the lowest biological activity. IL-17F shows about 100–1000 times lower affinity to the IL-17RA subunit than IL-17A, and does not compete with IL-17A binding to IL-17RA[1][2].
IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][3][4].

In Vitro

IL-17F (100 ng/mL; overnight) induces proinflammatory cytokines and chemokines in vitro via IL-17RA, TRAF6, and Act1 in mouse embryonic fibroblasts (MEFs)[5].

In Vivo

IL-17F (0.5 μg/mouse; i.p.; once) results in the recruitment of neutrophils within 4 h in mice[5].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q7TNI7 (R29-A161)

Gene ID

257630  [NCBI]

Molecular Construction
N-term
IL-17F (R29-A161)
Accession # Q7TNI7
6*His
C-term
Synonyms
Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL17F; IL24
AA Sequence

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Molecular Weight

17-23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17F Protein, Mouse (133a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17F Protein, Mouse (133a.a, HEK293, His)
Cat. No.:
HY-P72584
Quantity:
MCE Japan Authorized Agent: