IL-1RL2 Protein, Mouse (A158V, HEK293, His)
Based on 1 Customer Validation
The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
IL-1RL2 Protein serves as the receptor for interleukin-36 (IL36A, IL36B, and IL36G). Upon binding to interleukin-36, it forms a complex with the coreceptor IL1RAP, constituting the interleukin-36 receptor complex. This complex plays a pivotal role in mediating interleukin-36-dependent activation of NF-kappa-B, MAPK, and other signaling pathways. The IL-36 signaling system is believed to be present in epithelial barriers, participating in local inflammatory responses and sharing similarities with the IL-1 system. IL-1RL2 appears to be involved in the skin's inflammatory response, potentially inducing the IL-23/IL-17/IL-22 pathway. These interactions highlight the significance of IL-1RL2 in the regulation of immune responses, particularly in the context of epithelial barriers and local inflammation.
Verified Bioactivity
Immobilized IL-1F5 (HY-P77007) at 1 μg/mL (100 μL/well) can bind IL-1RL2 Protein. The ED50 for this effect is 2.046 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9ERS7 (D22-R338, A158V)
-
Molecular Construction
-
N-term
-
IL-1RL2 (D22-R338, A158V)
Accession # Q9ERS7 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL1RL2; Interleukin-1 Receptor-Related Protein 2; Interleukin 1 Receptor Like 2; Interleukin-1 Receptor-Like 2; IL1R-Rp2; IL-36 Receptor; IL1RRP2; IL-1Rrp2; IL-36R; IL-1 Receptor-Related Protein 2
-
AA Sequence
DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR
-
Predicted Molecular Mass
36.9 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
