1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-1 Rrp2
  5. IL-1RL2 Protein, Mouse (A158V, HEK293, His)

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

Cat. No.: HY-P70748
COA Handling Instructions

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-1RL2 Protein, Mouse (A158V, HEK293, His) is 317 a.a., with molecular weight of 50-70 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-1RL2 Protein, Mouse (A158V, HEK293, His) is 317 a.a., with molecular weight of 50-70 kDa.

Background

IL-1RL2 Protein serves as the receptor for interleukin-36 (IL36A, IL36B, and IL36G). Upon binding to interleukin-36, it forms a complex with the coreceptor IL1RAP, constituting the interleukin-36 receptor complex. This complex plays a pivotal role in mediating interleukin-36-dependent activation of NF-kappa-B, MAPK, and other signaling pathways. The IL-36 signaling system is believed to be present in epithelial barriers, participating in local inflammatory responses and sharing similarities with the IL-1 system. IL-1RL2 appears to be involved in the skin's inflammatory response, potentially inducing the IL-23/IL-17/IL-22 pathway. These interactions highlight the significance of IL-1RL2 in the regulation of immune responses, particularly in the context of epithelial barriers and local inflammation.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9ERS7 (D22-R338)

Gene ID

107527  [NCBI]

Molecular Construction
N-term
IL-1RL2 (D22-R338)
Accession # Q9ERS7
6*His
C-term
Synonyms
Interleukin-1 receptor-like 2; IL1RL2; IL-36 receptor; IL-36R; IL-1Rrp2; IL1R-rp2
AA Sequence

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Weight

50-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IL-1RL2 Protein, Mouse (A158V, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1RL2 Protein, Mouse (A158V, HEK293, His)
Cat. No.:
HY-P70748
Quantity:
MCE Japan Authorized Agent: