IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

IL-1RL2 Protein serves as the receptor for interleukin-36 (IL36A, IL36B, and IL36G). Upon binding to interleukin-36, it forms a complex with the coreceptor IL1RAP, constituting the interleukin-36 receptor complex. This complex plays a pivotal role in mediating interleukin-36-dependent activation of NF-kappa-B, MAPK, and other signaling pathways. The IL-36 signaling system is believed to be present in epithelial barriers, participating in local inflammatory responses and sharing similarities with the IL-1 system. IL-1RL2 appears to be involved in the skin's inflammatory response, potentially inducing the IL-23/IL-17/IL-22 pathway. These interactions highlight the significance of IL-1RL2 in the regulation of immune responses, particularly in the context of epithelial barriers and local inflammation.

Immobilized IL-1F5 (HY-P77007) at 1 μg/mL (100 μL/well) can bind IL-1RL2 Protein. The ED₅₀ for this effect is 2.046 μg/mL.

• 
  Immobilized IL-1F5 (HY-P77007) at 1 μg/mL (100 μL/well) can bind IL-1RL2 Protein, the ED₅₀ for this effect is 2.046 μg/mL.

Mouse

HEK293

C-6*His

Q9ERS7 (D22-R338, A158V)

107527  [NCBI]

Extracellular Domain

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

50-70 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.