IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293, C-His)

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with C-6*His labeled tag. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293, C-His), has molecular weight of (40-55) & 19 kDa, respectively.

IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.

Mouse

HEK293

C-6*His

Q9EQ14 (V22-A196)&P43432 (M23-S335)

83430  [NCBI]&16160  [NCBI]

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

(40-55) & 19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 5% Trehalose ,5% Mannitol, 0.01% Tween 80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.